SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001389 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001389
Domain Number 1 Region: 29-258
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.71e-69
Family Eukaryotic proteases 0.00000000537
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001389   Gene: ENSNLEG00000001174   Transcript: ENSNLET00000001468
Sequence length 262
Comment pep:novel supercontig:Nleu1.0:GL397303.1:174045:181392:1 gene:ENSNLEG00000001174 transcript:ENSNLET00000001468 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRNSYRFLASSLSVVVFLLLIPEDVCEKIIGGNEVTPHSRPYMVLLRLDKKTICAGALIA
KDWVLTAAHCNLNKRSQVILGAHSITREEPQKQIMLVKKEFPYPCYDPATHEGDLKLLQL
TEKAKINKYVTILHLPKKGDDVKPGTMCQVAGWGRSHNSASWSDTLREVNITIIDRKVCN
DQNHYNFNPVIGMNMVCDGSLQGGKDSCNGDSGSPLFCKGVFRGVTSFGLENKCGDPHWP
GVYILLSKKHLNWIIMTIKGAV
Download sequence
Identical sequences G1QKE4
XP_003265972.1.23891 ENSNLEP00000001389 ENSNLEP00000001389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]