SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001421 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001421
Domain Number 1 Region: 692-898
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.1e-49
Family BCR-homology GTPase activation domain (BH-domain) 0.0000823
Further Details:      
 
Domain Number 2 Region: 318-485
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 8.89e-25
Family FCH domain 0.029
Further Details:      
 
Domain Number 3 Region: 619-672
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000179
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001421   Gene: ENSNLEG00000001199   Transcript: ENSNLET00000001500
Sequence length 942
Comment pep:novel supercontig:Nleu1.0:GL397406.1:822495:840920:1 gene:ENSNLEG00000001199 transcript:ENSNLET00000001500 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRGQRVLKGLLGWVCSWTRAWRARLGASGCGLHVLCPGDLPLPPERLGVGDGGDPTLPG
PAGARPRPRVGWPATMTLPTPTRKWGPPSSPPLRPRPGCGLGRTHRSPLTAASPGELPTE
GGPDVVEDISHLLADVARFAEGLEKLKECVLRDDLLEARRPLAHECLGEALRVMRQIISK
YPLLNTVETLTAAGTLIAKVKAFHYESNNDQEKQREAQEGDQGGLAPRPEEAGEADGGGQ
RASARRSPSHSPSPIAGTLRRAPHTPRPLAHVRPRRLSPKPGRRCSSPIAPSSAWKDPGA
RRSLLSLQKWGEAVPLSVQEAESNLRKAKQGYMQRCEDHDKARFLVAKAEEEQAGTAPGA
GSTATKTLDKRRRLEDEAKNKAEEAMATYRTCVADAKTQKQELEDTKVTALRQIQEVIRQ
SDQTIKSATISYYQMMHMQTAPLPVHFQMLCESSKLYDPGQQYASHVRQLQRDQEPDVHY
DFEPHVSANAWSPVMRARKSSFNVSDVAGPEAAGSPPEEGGCIEGAPAKEHRAGRGHQVH
KSWPLSTSDCGLDPGPGAGDFKKFERTSSSGTMSSTEELVDPEGGAGASAFEQADLNGMT
PELPVAVPSGPFRHEGLSKAARTHRLRKLRTPAKCRECNSYVYFQGAECEECCLACHKKC
LETLAIQCGHKKLQGRLQLFGQDFSYAARSAPDGVPFIVKKCVCEIERRALRTKGIYRVN
GVKTRVEKLCQAFENGKELVELSQASPHDISNVLKLYLRQLPEPLISFRLYHELVGLAKD
SLKAEAEAKAASRGRQDGSESEAVAVAMAGRLRELLRDLPPENRASLQYLLRHLRRIVEV
EQDNKMTPGNLGIVFGPTLLRPRPTEATVSLSSLVDYPHQARVIETLIVHYGLVFEEEPE
ETPGGQDESSNQRAEVVVQVPYLEAGEGVVYPLQEAAEDGCR
Download sequence
Identical sequences ENSNLEP00000001421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]