SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Nomascus leucogenys 69_1.0 > ENSNLEP00000001513

Domain assignment for ENSNLEP00000001513 from Nomascus leucogenys 69_1.0

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSNLEP00000001513
Domain Number 1	Region: 6-111
Classification Level	Classification	E-value
Superfamily	Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain	5.23e-33
Family	Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain	0.0000164
Further Details:

Domain Number 2	Region: 205-334
Classification Level	Classification	E-value
Superfamily	Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain	1.83e-24
Family	Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain	0.0012
Further Details:

Domain Number 3	Region: 110-179
Classification Level	Classification	E-value
Superfamily	FAD/NAD(P)-binding domain	0.000000259
Family	Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain	0.0015
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Biological Process	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSNLEP00000001513 Gene: ENSNLEG00000001292 Transcript: ENSNLET00000001600
Sequence length	341
Comment	pep:novel supercontig:Nleu1.0:GL398241.1:7115:21544:-1 gene:ENSNLEG00000001292 transcript:ENSNLET00000001600 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	AGTRGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTLEIREGRGC GPEEDHVYLQLHHLPPEQLATRLRGISETAVIFIGVDVMKEPIPVLPTVHYNMDGIPTSY KGQVLRHVNGQDQIVPGLYTCGEAACASVHGANRLGANSLLDLVVGQACALSIEKSCRPG DKVPPIKPNAGEESVMNLDKLRFADGSIRTSELRLSMQKSVQNRAAVFRVGSVLQEGCGK IKLCRDLKDLKTFTPGMVWNTDLVETLELQNLMLCAPQTISGAEAWKESRGAQAREDCKV WINECDHSKPIQGKQKKPFEKHWRKHTLSYLDVSTGKVSVE
Download sequence
Identical sequences	ENSNLEP00000001513 ENSNLEP00000001513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]