SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001661 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001661
Domain Number 1 Region: 74-207
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 8.11e-34
Family Canonical RBD 0.0000222
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000001661
Domain Number - Region: 16-65
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0207
Family beta-sandwich domain of Sec23/24 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001661   Gene: ENSNLEG00000001278   Transcript: ENSNLET00000001758
Sequence length 471
Comment pep:novel supercontig:Nleu1.0:GL397348.1:8708300:8727089:1 gene:ENSNLEG00000001278 transcript:ENSNLET00000001758 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSNKTFNLEKQNHTPRKHHQHHHQQQHHQQQQQQPPPPPIPANGQQASSQNEGLTIDLK
NFRKPGEKTFTQRSRLFVGNLPPDITEEEMRKLFEKYGKAGEVFIHKDKGFGFIRLETRT
LAEIAKVELDNMPLRGKQLRVRFACHSASLTVRNLPQYVSNELLEEAFSVFGQVERAVVI
VDDRGRPSGKGIVEFSGKPAARKALDRCSEGSFLLTTFPRPVTVEPMDQLDDEEGLPEKL
VIKNQQFHKEREQPPRFAQPGSFEYEYAMRWKALIEMEKQQQDQVDRNIKEAREKLEMEM
EAARHEHQVMLMRQDLMRRQEELRRMEELHNQEVQKRKQLELRQEEERRRREEEMRRQQE
EMMRRQQEGFKGTFPDAREQEIRMGQMAMGGAMGINNRGAMPPAPVPAGTPAPPGPATMM
PDGTLGLTPPTTERFGQAATMEGIGAIGGTPPAFNRAAPGAEFAPNKRRRY
Download sequence
Identical sequences A0A096MM00 A0A0S2Z4Z9 A0A2J8UBM0 A0A2K5ED14 A0A2K5HUE0 A0A2K6A9N4 A0A2K6ASM7 F6R552 G7NRV6 G7Q300 H2QYS5 Q15233 Q5RFL9
ENSP00000276079 ENSP00000362947 ENSP00000362963 9544.ENSMMUP00000040988 9598.ENSPTRP00000037845 9606.ENSP00000276079 ENSCJAP00000024753 gi|224028244|ref|NP_001138880.1| gi|224028246|ref|NP_001138881.1| gi|34932414|ref|NP_031389.3| NP_001124612.1.23681 NP_001138880.1.87134 NP_001138880.1.92137 NP_001138881.1.87134 NP_001138881.1.92137 NP_031389.3.87134 NP_031389.3.92137 XP_001091198.1.72884 XP_001091316.1.72884 XP_002763022.1.60252 XP_003272746.1.23891 XP_003272747.1.23891 XP_003272748.1.23891 XP_003820184.1.60992 XP_003820185.1.60992 XP_003820186.1.60992 XP_005593965.1.63531 XP_005593966.1.63531 XP_008987714.1.60252 XP_011731049.1.29376 XP_011731050.1.29376 XP_011798485.1.43180 XP_011798486.1.43180 XP_011798487.1.43180 XP_011847452.1.47321 XP_011847453.1.47321 XP_011847454.1.47321 XP_012330452.1.9421 XP_012330453.1.9421 XP_012330454.1.9421 XP_016798135.1.37143 XP_016798136.1.37143 XP_016798137.1.37143 XP_017823918.1.60252 ENSP00000276079 ENSPTRP00000037845 ENSMMUP00000026973 ENSP00000276079 ENSP00000362947 ENSP00000362963 ENSPTRP00000037845 ENSNLEP00000001661 ENSNLEP00000001661 ENSCJAP00000024753 ENSCJAP00000024761 ENSCJAP00000043799 ENSMMUP00000026973 ENSMMUP00000040987 ENSMMUP00000040988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]