SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001868 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001868
Domain Number 1 Region: 196-331,628-803
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 6.32e-52
Family Diacylglycerol kinase-like 0.015
Further Details:      
 
Domain Number 2 Region: 97-166
Classification Level Classification E-value
Superfamily Cysteine-rich domain 3.44e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000451
Further Details:      
 
Domain Number 3 Region: 1007-1089
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000000214
Family SAM (sterile alpha motif) domain 0.0052
Further Details:      
 
Domain Number 4 Region: 37-93
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000344
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0084
Further Details:      
 
Domain Number 5 Region: 2-51
Classification Level Classification E-value
Superfamily PH domain-like 0.000004
Family Pleckstrin-homology domain (PH domain) 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001868   Gene: ENSNLEG00000001525   Transcript: ENSNLET00000001976
Sequence length 1097
Comment pep:novel supercontig:Nleu1.0:GL397327.1:2857777:2933257:1 gene:ENSNLEG00000001525 transcript:ENSNLET00000001976 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCAENRKEMEDWISSLKSVQTREPYEVAQFNVEHFSGMHNWYACSHARPTFCNVCRESL
SGVTSHGLSCEVCKFKAHKRCAVRATNNCKWTTLASIGKDIIEDEDGVAMPHQWLEGNLP
VSAKCAVCDKTCGSVLRLQDWKCLWCKTMVHTACKDLYHPICPLGQCKVSIIPPIALNST
DSDGFCRATFSFCVSPLLVFVNSKSGDNQGVKFLRRFKQLLNPAQVFDLMNGGPHLGLRL
FQKFDNFRILVCGGDGSVGWVLSEIDKLNLNKQAICQLGVLPLGTGNDLARVLGWGGSYD
DDTQLPQILEKLERASTKMLDRWSIMTYELKLPPKASLLPGPPEAAEEFYMTIYEDSVAT
HLTKILNSDEHAVVISSAKSFLCEFSSQKISWKYTKFELIFKNHVSILFACSVLNEKLEQ
LLQALHTDSQAAPVLPGLSPLIVEEDAVESSSEESGESKEQLVDDVTPSSQKVKPREIML
ISNSWAQVIRPPQPPKSKFMDDPTVHPCEPANQSSDYDSTETDESKEEAKDDGAKESLTV
KTAPWSPDARTSYGHSQTDSVPGPAVAASKENLPVLNTRIICPGLRAGLAASIAGSSIIN
KMLLANIDPFGATPFIDPDPDSVDGYSEKCVMNNYFGIGLDAKISLEFNNKREEHPEKCR
SRTKNLMWYGVLGTRELLQRSYKNLEQRVQLECDGQYIPLPSLQGIAVLNIPSYAGGTNF
WGGTKEDDIFAAPSFDDKILEVVAIFDSMQMAVSRVIKLQHHRIAQCRTVKITIFGDEGV
PVQVDGEAWVQPPGIIKIVHKNRAQMLTRDRAFESTLKSWEDKQKCDSGKPVLRTHLYIH
HAIDLATEEVSQMQLCSQAAEELITRICDAATIHCLLEQELAHAVNACSHALNKANPRCP
ESLTRDTATEIAINVKALYNETESLLVGRVPMQLESPHEERVSNALHSVEVELQKLTEIP
WLYYILHPNEDEEPPMDCTKRNNRSTVFRIVPKFKKEKVQKQKTSSQPVQKWGTEEVAAW
LDLLNLGEYKDIFIRHDIRGAELLHLERRDLKNTVGERRDTKENGKHMDLGIPKVGHVKR
ILQGIKELGRSTPQSEV
Download sequence
Identical sequences ENSNLEP00000001868 ENSNLEP00000001868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]