SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000002046 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000002046
Domain Number 1 Region: 185-327
Classification Level Classification E-value
Superfamily PH domain-like 8.61e-40
Family Third domain of FERM 0.00041
Further Details:      
 
Domain Number 2 Region: 85-187
Classification Level Classification E-value
Superfamily Second domain of FERM 4.84e-27
Family Second domain of FERM 0.00014
Further Details:      
 
Domain Number 3 Region: 3-83
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.47e-21
Family First domain of FERM 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000002046   Gene: ENSNLEG00000001688   Transcript: ENSNLET00000002159
Sequence length 713
Comment pep:novel supercontig:Nleu1.0:GL397347.1:77270:127852:-1 gene:ENSNLEG00000001688 transcript:ENSNLET00000002159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLHLKVQFLDDSQKIFVVDQKSSGKALFNLSCSHLNLAEKEYFGLEFCSHSGNNVWLELL
KPITKQVKNPKEIVFKFIVKFFPVDPGHLREELTRYLFTLQIKKDLALGRLPCSDNCTAL
MVSHILQSELGDFHEETDRKHLAQTRYLPNQDCLEGKIMHFHQKHIGRSPAESDILLLDI
ARKLDMYGIRPHPASDGEGMQIHLAVAHMGVLVLRGNTKINTFNWAKIRKLSFKRKHFLI
KLHANILVLCKDTLEFTMASRDACKAFWKTCVEYHAFFRLSEEPKSKPKTLLCSKGSSFR
YSGRTQRQLLEYGRKGRLKSLPFERKHYPSQYHERQCRSSPDLLSDVSKQVEDLRLAYGG
GYYQNVNGVHASEPVLESRRRNSAVEVTFATELAHSKPEADPTLLHQSQSSSSFPYIYMD
PVFNTEFNPNPDPRDMFSERSPLSSFQTSCKFAGNHMSISSGLTSKVSPAKQLTYTDVPY
IPCTDQRVGIMPPQVFFYVDKPPQVPRRSPIRAEERTSPDSYAEPTAMKPAKRSPRNIRM
KSFQQDLQGLQEAIARTSGRSNINVGLEEEDPNLEDAFVYNIQEPTPKRSQSQSDMKTTR
FPFGSEFRPLGPCPALSHKADLFTDMFAGQELPAVLMDQSTAERYVASESSDSESEILKP
EYYALYGKEIRSPMARIRLSSGSLQLDEEDEDAYFNTPTEDRTSLKPFNYFLA
Download sequence
Identical sequences G1QM80
XP_003272667.1.23891 ENSNLEP00000002046 ENSNLEP00000002046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]