SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000002300 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000002300
Domain Number 1 Region: 328-525
Classification Level Classification E-value
Superfamily PUA domain-like 2.49e-39
Family LON domain-like 0.0075
Further Details:      
 
Domain Number 2 Region: 236-298
Classification Level Classification E-value
Superfamily RING/U-box 2.29e-16
Family RING finger domain, C3HC4 0.0066
Further Details:      
 
Domain Number 3 Region: 3-85
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000485
Family Tetratricopeptide repeat (TPR) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000002300   Gene: ENSNLEG00000001858   Transcript: ENSNLET00000002426
Sequence length 534
Comment pep:novel supercontig:Nleu1.0:GL397269.1:278982:301359:-1 gene:ENSNLEG00000001858 transcript:ENSNLET00000002426 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SEPSDLIVKIYRAESYAGLQEFKAAIEDLNAVLFQLPDWPEVYFRKGKVLCDAGFLGDAL
QLFLQCLALDEDFAPAKLQVQKILCDLLLPENLKEGLKESSWSSLPCTKNRPFDYPSVME
ESQSPSEPSPKQSEEIPEVTSEPVKGSLNRAQSAQSINSTEMPAREDCLKRVSSEPFLSV
QEKGVLLKRKLSLLEQDVIVNEDGRNKLKKQGETPNEVCMFSLAYGDIPEELIDVSDFEC
SLCMRLFFEPVTTPCGHSFCKNCLERCLDHAPYCPLCKESLKEYLADRRYCVTQLLEELI
VKYLPDELSERKKIYDEETAELSHLTKNVPIFVCTMAYPTVPCPLHVFEPRYRLMIRRSI
QTGTKQFGMCVSDTQNSFADYGCMLQIRNVHFLPDGRSVVDTVGGKRFRVLKRGMKDGYC
TADIEYLEDVKVENEDEIKNLRELHDLVYSQACSWFQNLRDRFRSQILQHFGSMPEREEN
LQAAPNGPAWCWWLLAVLPVDPRYQLSVLSMKSLKERLTKIQHILTYFSRDQSK
Download sequence
Identical sequences ENSNLEP00000002300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]