SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000002688 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000002688
Domain Number 1 Region: 241-401
Classification Level Classification E-value
Superfamily RNI-like 3.92e-41
Family 28-residue LRR 0.0000209
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000002688   Gene: ENSNLEG00000002236   Transcript: ENSNLET00000002832
Sequence length 559
Comment pep:novel supercontig:Nleu1.0:GL397298.1:1052802:1068438:-1 gene:ENSNLEG00000002236 transcript:ENSNLET00000002832 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEHSRNSDQEELLDEEINEDEILANLSAEELKELQSEMEVMAPDPSLPVGMIQKDQTDK
PPTGNFNHKSLVDYMYWEKASRRMLEDERVPVTFVKSEEKTQEEHEEIDKRNKNMAQYLK
EKLNNEIVANKRESKGSSNVQETDDEEDEEEDDDHDDEGEDDGEESEETNREEEGKAKEQ
IRNCENNCQQVTDKAFKEQRDRPEVQEQSEKKISKLDPKKLALDTSFLKVSARPSGNQTD
LDGSLRRARKNDPDMKELNLNNIENIPKEMLLDFVNAMKKNKHIKTFSLANVGADENVAF
ALANMLRENRSITTLNIESNFITGKGIVAIMRCLQFNETLTELRFHNQRHMLGHHAEMEI
ARLLKANNTLLKMGYHFELPGPRMVVTNLLTRNQDKQRQKRREEQKQQQLKEQKKLIAML
ENGLGLPPGMWEMLGGPMPDSRMQEFFQPLPPRPPNPQNISFSQRSEMKKPSQAPQYRTD
PDSFRVVKLKRIQRKSRMPEAREPPEKTNLKDVIKTLKPVPKNRPPPLVEITPRDQLLND
IRHSNVAYLKPVQLPKELA
Download sequence
Identical sequences G1QP22
ENSNLEP00000002688 ENSNLEP00000002688 XP_003264922.1.23891 XP_012357631.1.23891 XP_012357632.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]