SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000002720 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000002720
Domain Number 1 Region: 447-715
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.72e-76
Family Protein kinases, catalytic subunit 0.000000000129
Further Details:      
 
Domain Number 2 Region: 153-225
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.7e-24
Family Ras-binding domain, RBD 0.00035
Further Details:      
 
Domain Number 3 Region: 225-278
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000194
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000002720   Gene: ENSNLEG00000002139   Transcript: ENSNLET00000002866
Sequence length 764
Comment pep:novel supercontig:Nleu1.0:GL397332.1:1080336:1272706:-1 gene:ENSNLEG00000002139 transcript:ENSNLET00000002866 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALSGGGGSGAEPGQALFNGDMEPEAGAGAAASSAADPAIPEEVWNIKQMIKLTQEHIE
ALLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLESLGNGTDFSVSSSASMDTVTS
SSSSSLSVLPSSLSVFQNPTDVARSNPKSPQKPIVRVFLPNKQRTVVPARCGVTVRDSLK
KALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPLTTHNFVRKTF
FTLAFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDQLDLLFVSKFFEHHPIPQ
EEASLAETALTSGSSPSAPASDSVGPQILTSPSPSKSIPIPQPFRPADEDHRNQFGQRDR
SSSAPNVHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGP
QRERKSSSSSEDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAV
KMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLH
IIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKS
RWSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNR
DQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLP
KIHRSASEPSLNRAGFQTEDFSLYACASPKTPIQAGGYGAFPVH
Download sequence
Identical sequences G1QP54
ENSNLEP00000002720 ENSNLEP00000002720 XP_003270861.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]