SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000002781 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000002781
Domain Number 1 Region: 1810-2020
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4e-28
Family Extended AAA-ATPase domain 0.026
Further Details:      
 
Domain Number 2 Region: 2768-2890,2921-3037
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.3e-24
Family Extended AAA-ATPase domain 0.084
Further Details:      
 
Domain Number 3 Region: 2427-2708
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.22e-21
Family Extended AAA-ATPase domain 0.065
Further Details:      
 
Domain Number 4 Region: 2040-2254
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000346
Family ABC transporter ATPase domain-like 0.072
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000002781
Domain Number - Region: 3226-3310
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0157
Family FCH domain 0.036
Further Details:      
 
Domain Number - Region: 665-799
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.0299
Family DBL homology domain (DH-domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000002781   Gene: ENSNLEG00000002049   Transcript: ENSNLET00000002927
Sequence length 4471
Comment pep:novel supercontig:Nleu1.0:GL397391.1:669069:848972:1 gene:ENSNLEG00000002049 transcript:ENSNLET00000002927 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPEEVEVEIDEIPVLSEEEEEEETYSQKVESVDKVQAKHVSLRTESLGQPLINIEDEET
DKEISEKLPSKRTAKHIMEKMHLHMLCTPLPEEFLDQNAVFFLRNTKEAISEATDMKEAV
EIMPETLEYGIINANVLHFLKAIICQVFLPALSFNQHRTSTTVGVTSGEGSNSSEYESDL
PPTPGEAVEYHSIQLIRDEFLMNMQKFASNIQRTMQQLEGEIKLEMPTISVEGEVSDLAA
DPETVDILEQCVINWLNQISTAVEGQLKKTPQGKGPLAEIEFWRERNATLSALHEQTKLP
IVRKVLDVIKESDSMLVANLQPVFTELFKLHTEASDNVRFLSTVERYFKNITHGSGFHVV
LDTIPAMMSALRMVWIISRHYNKDERMIPLMERIAWEIAERVCRVVNLRTLFKENRASAQ
NKTLAARNTLRLWKKAYFDTRAKIEASGREARWEFDRKRLFQRTDYMATICQDLSDILQV
LEEFYNIFGPELKAVTGDPKRIDDVLCRVDGLVTPMENLTFDPFSIKSSQFWKYVMDEFK
IEVLIDIINKIFVQNLENPPLYKNHPPVAGAIYWERSLFFRIKHTILRFQEVQEILDSDR
GQEVKQKYLEVGKTMKEYEDRKYEQWMEVTEQVLPALMKKSLLTKSCIAMEEPSTLERGA
VFAINFSPALREIMNETKYLEQLGFTVPELARNIALQEDKFLRYTEGIQRMLDHYHMLIG
TLNEAESVLLNDHSQELLRVFRSGYKRLNWNSLGIGDYITCCKQAIGKFESLVHQIHKNT
DDISSRLTLIEAINLFKYPAAKSEKELPGVKEFFEHIERERARDVDHMVRWYLAIGPLLT
KVEGLVVHTNTGKAPKLASYYKYWEKKIYEVLTKLILKNLQSFNSLILGNVPLFYTETIL
TAPEIILHPNTNEIDKMCFHCVRNCVEITKHFVRWMNGSCIECPPQKGEEEEVVIINFYN
DISLNPQIIEQAVMIPQNVHRILINLMKYLQKWKRYRPLWKLDKAIVMEKFAAKKPPCVA
YDEKLQFYSKIAYEVMRHPLIKDEHCIRLQLGHLANTVQENAKSWVISLGKLLNESAKEE
LYNLHEEMEHLAENLRKIPNTLEDLKFVLATIAEIRSKSLVMELRYRDVQERYRTMAMYN
LFPPDAEKELVDKIESMWSNLFNDSVNVEHALGDIKRTFTEITRGEIMNYRVQIEEFAKR
FYSEGPGSVGDDLDKGVELLGVYERELARHEKSRQELANAEKLFDLPITMYPELLKVQKE
MSGLRMIYELYEGLKVAKEEWSQTLWINLNVQILQEGIEGFLRALRKLPRPVRGLSVAYY
LEAKMKAFKDSIPLLLDLKHEALRDRHWKELMEKTSVLFEMTETFTLENMFAMELHKHTD
VLNEIVTAAIKEVAIEKAVKEILDMWENMKFTVVKYYKGTQERGYILGSVDEIIQSLDDN
TFNLQSISGSRFVGPFLQTVQKWEKTLSLIGEVIEIWMLVQRKWMYLESIFIGGDIRSQL
PEEAKKFDNIDRVFKRIMGETLKDPVIKRCCEAPNRLSDLQNVSEGLEKCQKSLNDYLDS
KRNAFPRFFFISDDELLSILGSSDPLCVQEHMIKMYDNIASLRFNDGDSGEKLVSAMISA
EGEVMEFRKIVRAEGRVEDWMTAVLNEMRRTNRLITKEAIFRYCEDRSRVDWMLLYQGMV
VLAASQVWWTWEVEDVFHKVQKGEKQAMKNYGRKMHRQIDELVTRITMPLSKNDRKKYNT
VLIIDVHARDIVDSFIRGSILEAREFEWESQLRFYWDREPDELNIRQCTGTFGYGYEYMG
LNGRLVITPLTDRIYLTLTQALSMYLGGAPAGPAGTGKTETTKDLAKALGLLCVVTNCGE
GMDYKAVGKIFSGLAQCGSWGCFDEFNRIDASVLSVISSQIQTIRNALIHQLTTFQFEGQ
EISLDSRMGIFITMNPGYAGRTELPESVKALFRPVVVIVPDLQQICEIMLFSEGFLEAKT
LAKKMTVLYKLAREQLSKQYHYDFGLRALKSVLVMAGELKRGSSDLREDVVLMRALRDMN
LPKFVFEDVPLFLGLISDLFPGLDCPRVRYPDFSDAVEQVLEENGYAVLPVQVDKVVQMF
ETMLTRHTTMVVGPTRGGKSVVINTLCQAQTKLGLMTKLYILNPKAVSVIELYGILDPTT
RDWTDGVLSNIFREINKPTDKKERKYILFDGDVDALWVENMNSVMDDNRLLTLANGERIR
LQAHCALLFEVGDLQYASPATVSRCGMVYVDPKNLKYRPYWKKWVNQIPNKAEQYNLNSL
FEKYVPYLIDVIVEGIVDGRQAEKLKTIVPQTDLNMVTQLAKMLDALLEGEIEDLDLLEC
YFLEALYCSLGASLLEDGRMKFDEYIKRLASLSTVDTEGVWANPGELPGQLPTLYDFHFD
NKRNQWVPWSKLVPEYIHAPERKFIDILVHTVDTTRTTWILEQMVNIKQPVIFVGESGTS
KTATTQNFLKNLSEETNIVLMVNFSSRTTSMDIQRNLEANVEKRTKDTYGPPMGKRLLVF
MDDMNMPRVDEYGTQQPIALLKLLLEKGYLYDRGKELNCKSIRDLGFIAAMGKAGGGRNE
VDPRFISLFSVFNVPFPSEQSLHLIYSSILKGHTSTFHESIVAVSGKLTFCTLALYKNIV
QDLPPTPSKFHYIFNLRDLSRVFNGLVLTNPERFQTVAQMVRVWRNECLRVFHDRLISET
DKQLVQQHIGGLVTEHFNDDVEVVMRDPILFGDFRMALHEGEPRIYEDIQDYEAAKALFQ
EILEEYNESNTKMNLVLFDDALEHLTRVHRIIRMDRGHALLVGVGGSGKQSLSRLAAFTA
GCEVFEILLSRGYSENNFREDLKSLYLKLGIENKAMIFLFTDAHVAEEGFLELINNMLTS
GIVPALFAEEEKESVLSQIGQEALKQGMGPAKESVWQYFVNKSANNLHVVLGMSPVGDTL
RTWCRNFPGMVNNTGIDWFMPWPPQALHAVAKSFLGYNPMIPAENIENVVKHVVLVHESV
GHYSKQFLQKLRRSNYVTPKNYLDFINTYSKLLDEKTQYNIAQCKRLDGGLDKLKEATIQ
LDELNQKLAEQKIVLAEKSAACEALLEEIAVNTAVAEEKKKLAEEKAMEIEEQNKVIAME
KAEAETTLEEVMPILEAAKLELQKLDKSDVTEIRSFAKPPKQVQTVCECILIMKGYKELN
WKTAKGMMSDPNFLRSLMEIDFDSITQSQVKNIKGLLKTLNTTNEEMEAVSKAGLGMLKF
VEAVMGYCDVFREIKPKREKVARLERNFYLTKRELERIQNELAAIQKEMETLGAKYEAAI
LEKQKLQEEAEIMERRLIAADKLISGLGLENIRWLNDLDELMHRRVKLLGDCLLCAAFLS
YEGAFTWEFRDEMVNQIWQNDILEREIPLSQPFRLESLLTDDVEISRWGSQGLPPDELSI
QNGILTTRASRFPLCIDPQQQALNWIKRKEEKNNLRVASFHDPDFLKQLEMSIKYGTPFL
FRDVDEYIDPVIDNVLEKNIKISQGRQFIILGDKEVDYDSNFRLYLNTKLANPRYSPSVF
GKAMVINYTVTLKGLEDQLLSVLVAYERRELEEQREHLIQETSENKNLLKDLEDSLLREL
ATSTGNMLDNVDLVHTLEETKSKATEVSEKLKLAEKTALDIDRLRDGYRPAARRGAILFF
VLSEMALVNSMYQYSLIAFLEVFGLSLKKSLPDSILMKRLRNIMDTLTFNIYNYGCTGLF
ERHKLLFSFNMTIKIEQAEGRVPQEELDFFLKGNISLEKSKRKKPCAWLSDQGWEDIILL
SEMFSDNFGQLPDDVENNQTIWQEWYDLDSLEQFPFPLGYDNNITPFQKLLILRCFRVDR
VYRAVTDYVTVTMGEKYVQPPMISFEAIFEQSTPNSPIVFILSPGSDPASDLMKLAERSG
FGGNRLKFLAMGQGQEKVALQLLETAVARGQWLMLQNCHLLVKWLKDLEKSLERITKPHP
DFRLWLTTDPTKGFPIGILQKSLKVVTEPPNGLKLNMRATYFKISHEMLDQCPHPAFKPL
VYVLAFFHAVVQERRKFGKIGWNVYYDFNESDFQVCMEILNTYLTKAFQQRDPRIPWGSL
KYLIGEVMYGGRAIDSFDRRILTIYMDEYLGDFIFDTFQPFHFFRNKKVDYKIPVGDEKE
KFVEAIEALPLANTPEVFGLHPNAEIGYYTQAARDMWAHLLELQPQTGESSSGISRDDYI
GQVAKDIENKMPKVFDLDQVRKRLGTEISPTSVVLLQELERFNKLVVRMTKSLAELQRAL
AGEVGMSNELDDVARSLLIGHIPNIWRRLAPDTLKSLGNWMVYFLRRFSQYMLWVTESEP
SVMWLSGLHIPESYLTALVQATCRKNGWPLDRSTLFTQVTKFRDADEVNERAGQGCFVSG
LYLEGADWDIEKGCLIKSKPKVLVVDLPILKIIPIEVHRLKLQNTFRTPVYTTSMRRNAM
GVGLVFEADLFTTRHISHWVLQGVCLTLNSD
Download sequence
Identical sequences ENSNLEP00000002781 ENSNLEP00000002781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]