SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000002914 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000002914
Domain Number 1 Region: 238-397
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.34e-52
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000284
Further Details:      
 
Domain Number 2 Region: 25-134
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.76e-32
Family Spermadhesin, CUB domain 0.00067
Further Details:      
 
Domain Number 3 Region: 138-235
Classification Level Classification E-value
Superfamily LCCL domain 4.71e-24
Family LCCL domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000002914   Gene: ENSNLEG00000002359   Transcript: ENSNLET00000003063
Sequence length 736
Comment pep:novel supercontig:Nleu1.0:GL397284.1:5139736:5245412:-1 gene:ENSNLEG00000002359 transcript:ENSNLET00000003063 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTCLLLLLEDAGAQQGDGCGHTVLGPESGTLTSINYPQTYPNSTVCEWEIRVKMGERVRI
KFGDFDIEDSDSCHFNYLRIYNGIGVSRTEIGKYCGLGLQMNHSIESKGNEITLLFMSGI
HVSGRGFLASYSVIDKQDLITCLDTASNFLEPEFSKYCPAGCLLPFAEISGTIPHGYRDS
SPLCTAGVHAGVVSNTLGGQISVVISKGIPYYESSLANNVTSVVGHLSTSLFTFKTSGCY
GTLGMESGVIADPQVTASSVLEWTDHTGQENSWKPEKARLKKPGPPWAAFATDEYQWLQI
DLNKEKKITGIITTGSTMVEHNYYVSAYRILYSDDGQKWTVYREPGVEQDKIFQGNKDYH
QDVRNNFLPPIIARFIRVNPTQWQQKIAMKMELLGCQFIPKGRPPKFTQPPPPRNSNDLK
NTTNPPKIAKGRAPKFTQPLRPRSSNEFPAQTEQTTASPDIKNTTVTPNVTKDVALAAVL
VPVLVMVLTTLILILVCAWHWRNRKKKTEGTYDLPYWDRAGFYLMVSLAYRHNEGWWKGM
KQFLPAKAVDHEETPVRYSSSEVNHLSPREVTTVLQADSAEYAQPLVGGIVGTLHQRSTF
KPEEGKEAGYADLDPYNSPGQEVYHAYAEPLPITGPEYATPIIMDMSGHPTASVGLPSTS
TFKATGNQPPQLVGTYNTLLSRTDSCSSAQAQYDTPKGGKPGPPAPDELVYQVPQSTQEV
SGAGRDGECDVFKEIL
Download sequence
Identical sequences ENSNLEP00000002914 ENSNLEP00000002914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]