SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003379 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003379
Domain Number 1 Region: 391-674
Classification Level Classification E-value
Superfamily RNI-like 3.14e-40
Family 28-residue LRR 0.016
Further Details:      
 
Domain Number 2 Region: 164-415
Classification Level Classification E-value
Superfamily RNI-like 1.28e-33
Family Cyclin A/CDK2-associated p19, Skp2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003379   Gene: ENSNLEG00000002688   Transcript: ENSNLET00000003546
Sequence length 1370
Comment pep:novel supercontig:Nleu1.0:GL397291.1:16366988:16732245:1 gene:ENSNLEG00000002688 transcript:ENSNLET00000003546 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEESSDVPRELIESIKDVIGRKIKISVKKKVKLEVKGDKVENKVLVLTSCRAFLVTARI
PTKLELTFSYLEIHGVICSKSAQMVVETEKCSISMKMASPEDVSEVLAHIGTCLRKIFPG
LSPVRIMKKVSMEPSERLASLQALWDSQTVAEQGPCGGFSQMYACVCDWLGFSYREEVQW
DVDTIYLTQDTRELNLQDFSHLDHRDLIPIIAALEYNQWFTKLSSKDLKLSTDVCEQILR
VVSRSNRLEELVLENAGLRTDFAQKLASALAHNPNSGLHTINLAGNPLEDRGVSSLSIQF
AKLPKGLKHLNLSKTSLSPKGVNSLSQSLSANPLTASTLVHLDLSGNVLRGDDLSHMYNF
LAQPNAIAHLDLSNTECSLDMVCGALLRGCLQYLAVLNLSRTVFSHRKGKEVPPSFKQFF
SSSLALMHINLSGTKLSPEPLKALLLGLACNHNLKGVSLDLSNCELRSGGAQVLEGCIAE
IHNITSLDISDNGLESDLSTLIVWLSKNRSIQHLALGKNFNNMKSKNLTPVLDNLVQMIQ
DEESPLQSLSLADSKLKTEVTIIINALGSNTSLTKVDISGNGMGDMGAKMLAKALQINTK
LRTVIWDKNNITAQGFQDIAVAMEKNYTLRFMPIPMYDASQALKTNPEKTEDALQKIENY
LLRNHETRKYLQEQAYRLQQGIVTSTTQQMIDRICVKVQDHLNSLRNCGGDAIQEDLKSA
ERLMRDAKNSKTLLPNLYHVGGASWAGASGLLSSPIQETLESMAGEVTRVVDEQLKALLE
SMVDAAENLCPNVMKKAHIRQDLIHASTEKISIPRTFVKNVLLEQSGIDILNKISEVKLT
VASFLSDRIVDEILDALSHCHHKLADHFSRRGKTLPQQESLEIELAEEKPVKRSIITVEE
LTEIERLEDLDTCMMTPKSKRKSIHSRMLRPVSRAFEMEFDLDKALEEVPIHVEDPPFPS
LRQEKRSSGFISELPSEEGKKLEHFTKLRPKRNKKQQPTQAAVCAANIVSQDGEQNGLMG
RVDEGVDEFFTKRVTKMDSKKWSTRGSESHELNEGGDEKKKRDSRKSSGFLNLIKSRSKS
ERPPTIQKNPPSTPKGAVRSPPVDCPRKDTKAAEHNGNSERIEEIKTPDSFEESQGEEIG
KVERSDSKSSPQGGRRYGVQVMGSGLLAEMKAKQEKRAACAQKKLGNDAVSQDSSSPALS
SVERLDGGGAVPKLHPGLPENRFGLGTPEKNTKAEPKAEAGSRSRSSSSTPTSPKPLLQS
PKPSLAARPVIPQKPRTASRPDDIPDSPSSPKVALLPPVLKKVPLDKERDGQSSPQPSPR
TFSQEVSRRSWGQQAQEYQEQKQRSSSKDGHQGSKSSDSGEEAEKEFIFV
Download sequence
Identical sequences ENSNLEP00000003379 ENSNLEP00000003379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]