SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003407 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003407
Domain Number 1 Region: 549-824
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.23e-77
Family Protein kinases, catalytic subunit 0.0000276
Further Details:      
 
Domain Number 2 Region: 397-507
Classification Level Classification E-value
Superfamily PH domain-like 8.53e-36
Family Pleckstrin-homology domain (PH domain) 0.000000608
Further Details:      
 
Domain Number 3 Region: 116-169
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000553
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0021
Further Details:      
 
Domain Number 4 Region: 288-313
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000209
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003407   Gene: ENSNLEG00000002792   Transcript: ENSNLET00000003574
Sequence length 841
Comment pep:novel supercontig:Nleu1.0:GL397417.1:2172447:2218689:-1 gene:ENSNLEG00000002792 transcript:ENSNLET00000003574 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATSSYPAGLPGSPGPGSPPPPGGLELQSPPPLLPQIPAPGSGVSFHIQIGLTREFVLL
PAASELAHVKQLACSIVDQKFPECGFYGLYDKILLFKHDPTSANLLQLVRSAGDIQEGDL
VEVVLSASATFEDFQIRPHALTVHSYRAPAFCDHCGEMLFGLVRQGLKCDGERKGWGRSG
AQSWGRSLGSNNGKKDGPRSRAWGKSNSQRIPEILDSQNFERSNSRFQPGRSLEPRSLRP
AWATWQNPVSTKKLKISQAWQHASTLLSLRLRVKVQAFQVTSLPLLTRPLVPCPDCKFNC
HKRCATRVPNDCLGEALINGDVPMEEATDFSEADKSALMDESEDSGVIPGSHSENALHAS
EEEEGEGGKAQSSLGYIPLMRVVQSVRHTTRKSSTTLREGWVVHYSNKDTLRKRHYWRLD
CKCITLFQNNTTNRYYKEIPLSEILTVESAQNFSLVPPGTNPHCFEIVTANATYFVGEMP
GGAPGGPSGQGAEAARGWETAIRQALMPVILQDAPSAPGHAPHRQASLSISVSNSQIQEN
VDIATVYQIFPDEVLGSGQFGVVYGGKHRKTGRDVAVKVIDKLRFPTKQSQLRNEVSILQ
SLRHPGIVNLECMFETPEKVFVVMEKLHGDMLEMILSSEKGRLPERLTKFLITQILVALR
HLHFKNIVHCDLKPENVLLASADPFPQVKLCDFGFARIIGEKSFRRSVVGTPAYLAPEVL
LNQGYNRSLDMWSVGVIMYVSLSGTFPFNEDEDINDQIQNAAFMYPASPWSHISAGGAWG
APTPWAAIDLINNLLQVKMRKRYSVDKSLSHPWLQEYQTWLDLRELEGKMGERYITHESD
D
Download sequence
Identical sequences ENSNLEP00000003407 ENSNLEP00000003407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]