SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003609 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003609
Domain Number 1 Region: 98-515
Classification Level Classification E-value
Superfamily ARM repeat 2.09e-16
Family HEAT repeat 0.074
Further Details:      
 
Domain Number 2 Region: 1760-1811
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000899
Family RING finger domain, C3HC4 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003609   Gene: ENSNLEG00000002867   Transcript: ENSNLET00000003785
Sequence length 1812
Comment pep:novel supercontig:Nleu1.0:GL397293.1:14494218:14560314:-1 gene:ENSNLEG00000002867 transcript:ENSNLET00000003785 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRVSGGKGPGGSYYSESSSGARDRKLCPGRVNRGLSAQSTAATATMGGKNKQRTKGNLR
PSNSGRAAELLAKEQGTVPGFIGFGTSQSDLGYVPAIQGAEEIDSLVDSDFRMVLRKLSK
KDVTTKLKAMQEFGTMCTERDTETVKGVLPYWPRIFCKISLDHDRRVREATQQAFEKLIL
KVKKQLAPYLKSLMGYWLMAQCDTYTPAAFAAKDAFEAAFPPSKQPEAIAFCKDEITSVL
QDHLIKETPDTLSDPQTVPEEEREAKFYRVVTCSLLALKKLLCLLPDNELDSLEEKFKSL
LSQNKFWKYGKHSVPQIRSAYFELVSALCQRIPQLMKEEASKVSPSVLLSIDDSDPIVCP
ALWEAVLYTLTTIEDCWLHVNAKKSVFPKLSTVIREGGRGLATVIYPYLLPFISKLPQSI
THPKLYFFKNFLTSLVAGLSTERTKTSSSESSAVISAFFECLRFIMQQNLGEEEIEQMLI
NDQLIPFIDAVLKDPGLQHGQLFNHLAETLSSWEAKADMEKDEKTAHNLENVLIHFWERL
SEICVAKINEPEADVESVLGVSNLLQVLQKPKSSLKSNKKKNGKVRFADEILESNKENEK
CLSSEGENIEGWELTTEPSLTHSSSGLLSPLRKKPLEDLVCKLADISINYVNEQKSEQHL
RFLSTLLDSFSSSRVFKMLLGDEKQSIVQAKPLEIAKLAQKNPAVQFLYQKLTGWLNEDQ
RKDFGFLVDILYSALRCCDNDMERKKVLDDLTKVDLKWNSLLKIIEKACSSSDKHALVTP
WLKGDILGEKLVNLADCLCNEDWESRVSSESHFSERWTLLSLVLSQHVKNDYLIGDVYVE
RIIVKLHETLFKTKKLSEAENSDSSVSFICDVAYNYFSSATGCLLMPSSEDLLLTLFQLC
AQSKEKTHLPDFLICKLKNTWLSGVNLLVHQTDSSYKESTFLHLSALWLKNQVQASSLDI
NSLQVLLSAVDDLLNTLLESEDSYLMGVYIGSVMPNDSEWEKMRQSLPMQWLHRPLLEGR
LSLNYECFKTDFKEQDIKALPSHLCTSALLSKMVLIALRKETVLENNELEKIISELLYSL
QWCEELDNPPIFLTGFCEMLQKMNITYDNLRVLGNTSGLLQLLFHRSREHGTLWSLIIAK
LILSRSISSDEVKPHYKRKESFFPLTEGNLHTIQSLCPFLSKEEKKEFSAQCIPALLGWT
KKDLCSTNGGFGHLAIFNSCLQTKSIDDGELLHGILKIIISWKKEHEDIFLFSCNLSEAS
PEVLGVNIEIIRFLSLFLKYCSSPLAESEWDFIMCSMLAWLETTSENQALYSIPLVQLFA
CVSCDLACDLSAFFDSTTLDTIGNLPVNLISEWKEFFSQGIHSLLLPILVTVTGENRDVS
ETSFQNAMLKPMCETLTYISKEQLLSHKLPARLVADQKTNLPEYLQTLLNTLAPLLLFRA
RPVQIAVYHMLYKLMPELPQYDQDNLKSYGDEEEEPALSPPAALMSLLSTQEDLLENVLG
CIPVGQIVTIKPLSEDFCYVLGYLLTWKLILTFFKAASSQLRALYSMYLRKTKSLNKLLY
HLFRLMPENPTYAETATEVPSKDPKTFFTEELQLSIRETTTLPYHIPHLACSVYHMTLKD
LPAMVRLWWNSSEKRVFNIVDRFTSKYVSSVLSFQEISSVQTSTQLFNGMTVKARATTRE
VMATYTIEDIVIELIIQLPSNYPLGSITVESGKRVGVAVQQWRNWMLQLSTYLTHQNGSI
MEGLALWKNNVDKRFEGVEDCMICFSVIHGFNYSLPKKACRTCKKKFHSACLYKWFTSSN
KSTCPLCRETFF
Download sequence
Identical sequences G1QRP1
XP_003263863.1.23891 ENSNLEP00000003609 ENSNLEP00000003609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]