SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004009 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000004009
Domain Number 1 Region: 639-823
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.4e-52
Family DBL homology domain (DH-domain) 0.000000177
Further Details:      
 
Domain Number 2 Region: 831-960
Classification Level Classification E-value
Superfamily PH domain-like 3.92e-35
Family Pleckstrin-homology domain (PH domain) 0.0000172
Further Details:      
 
Domain Number 3 Region: 325-466
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000119
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 4 Region: 135-231
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0000759
Family CRAL/TRIO domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004009   Gene: ENSNLEG00000003068   Transcript: ENSNLET00000004206
Sequence length 1070
Comment pep:novel supercontig:Nleu1.0:GL397347.1:7589902:7711440:-1 gene:ENSNLEG00000003068 transcript:ENSNLET00000004206 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQAAALAPWTSVSCCRIPGLPQNPDGCTFMPIAQAIPLQVDMAMALXXXXXXXXYLNMY
VISSIFLFVIETDLLLCIKDISHFLMQDIAFLSGGRGKDNAWIITFPENCNFRCIPEEVI
AKVLTYLTSIARQNGSDSRFTIILDRRLDTWSSLKISLQKISASFPGNLHLVLVLRPTSF
LQRTFTDIGFRFSQEDFMLKLPVVMLSSVSDLLTYIDDKQLTPELGGTLQYCHSEWIIFR
NAIENFALTVKEMAQMLQSFGTELAETELPDDIPSIEEILAIRAERYHLLKNDITAVTKE
GKILLTNLEVPDTEGAVSSRLECHQQISGDWQTINKLLTQVHDMETAFDGFWEKHQLKME
QYLQLWKFEQDFQQLVTEVEFLLNQQAELADVTGTIAQVKQKIKKLENLDENSQELLSKA
QFVILHGHKLAANHHYALDLICQRCNELRYLSDILVNEIKAKQKQLSRTFKMHKLLQQAR
QCCDEGECLLANQEIDKFQSKEDAQKALQDIENFLEMALPFINYEPETLQYEFDVILSPE
LKVQMKTIQLKLENIRSIFENQQAGFRNLADKHVRPIQFVVPTPENLVTSGTPFFSSKQG
KKTWRQNQSNLKIEVLHDCQEKRSSGESSSLDNGNSLDVLKNHVLNELIQTERVYVQELY
TVLLGYRAEMDNPEMFDLMPSLLRNKKDVLFGNMAEIYEFHNDIFLSNLENCAYAPERVG
PCFLERKDDFQMYAKYCQNKPRSETIWRKYSECAFFQECQRKLNHKLRLDSYLLKPVQRI
TKYQLLLKELLKYSKDCEGSALLKEALDAMLDLLKSVNDSMHQIAINGYIGNLNELGKMI
MQGGFSVWIGHKKGATKMKDLARFKPMQRHLFLYEKAIVFCKRRVESGEGSDRYPSYNFK
HCWKMDEVGITEYVKGDNRKFEIWYGEKEEVYIVQASNVDVKMTWLKEIRNILLKQQELL
TVKKRKQQDQLTERDKIQISLQQNDEKQQGAFISTEETESEHTSTVVEVCEAIASVQAEA
NTVWTEASQSAEISEEPEEWSSNYFYPTYDENEEENRPLMRPVSEMALLY
Download sequence
Identical sequences ENSNLEP00000004009 ENSNLEP00000004009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]