SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004071 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000004071
Domain Number 1 Region: 297-583
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.38e-66
Family Protein kinases, catalytic subunit 0.00000000389
Further Details:      
 
Domain Number 2 Region: 20-90
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.31e-22
Family Ras-binding domain, RBD 0.0000213
Further Details:      
 
Domain Number 3 Region: 92-144
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000209
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004071   Gene: ENSNLEG00000003341   Transcript: ENSNLET00000004271
Sequence length 603
Comment pep:novel supercontig:Nleu1.0:GL397333.1:11994215:12003854:1 gene:ENSNLEG00000003341 transcript:ENSNLET00000004271 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPPRGPPANGAEPSRAVGTVKVYLPNKQRTVVTVRDGMSVYDSLDKALKVRGLNQDCCV
VYRLIKGRKTVTAWDTAIAPLDGEELIVEVLEDVPLTMHNFVRKTFFSLAFCDFCLKFLF
HGFRCQTCGYKFHQHCSSKVPTVCVDMSTSRQQFYHSVQDLSGGSRQHEPSNRPLNELLT
PQVPAMNNSTASGHSLSFPLQPRTQHWQEGRAMPVGLHALFLTPVPLLLLTGQSFSTDAA
CSRGGSDGTPRGSPSPASVSSGRKSPHSKSPAEQRERKSLADDKKKVKNLGYRDSGYYWE
VPPSEVQLLKRIGTGSFGTVFRGRWHGDVAVKVLKVSQPTAEQAQAFKNEMQVLRKTRHV
NILLFMGFMTRPGFAIITQWCEGSSLYHHLHVADTRFDMVQLIDVARQTAQGMDYLHAKN
IIHRDLKSNSIYLLLEGLTVKIGDFGLATVKTRWSGAQPLEQPSGSVLWMAAEVIRMQDP
NPYSFQSDVYAYGVVLYELMTGSLPYSHIGCRDQIIFMVGRGYLSPDLSKISSNCPKAMR
RLLSDCLKFQREERPLFPQILATIELLQRSLPKIERSASEPSLHRTQADELPACLLSAAR
LVP
Download sequence
Identical sequences ENSNLEP00000004071 ENSNLEP00000004071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]