SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004091 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000004091
Domain Number 1 Region: 215-356
Classification Level Classification E-value
Superfamily PH domain-like 1.5e-42
Family Third domain of FERM 0.000000431
Further Details:      
 
Domain Number 2 Region: 107-214
Classification Level Classification E-value
Superfamily Second domain of FERM 1.1e-37
Family Second domain of FERM 0.000000679
Further Details:      
 
Domain Number 3 Region: 19-103
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.48e-25
Family First domain of FERM 0.00000532
Further Details:      
 
Domain Number 4 Region: 478-553
Classification Level Classification E-value
Superfamily Moesin tail domain 7.59e-20
Family Moesin tail domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004091   Gene: ENSNLEG00000003205   Transcript: ENSNLET00000004292
Sequence length 601
Comment pep:novel supercontig:Nleu1.0:GL397272.1:1959367:2047061:1 gene:ENSNLEG00000003205 transcript:ENSNLET00000004292 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETW
FFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFL
QVKKQILDEKIYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMT
PEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALG
LHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLC
IGNHDLFMRRRKADSLEVQQMKAQAREEKARKQMERQRLAREKQMREEAERTRDELERRL
LQMKEEATMANEALVISEEAEQEMQRIKATAIRTEEEKRLMEQKVLEAEVLALKMAEESE
RRAKEADQLKQDLQEAREAERRAKQKLLEIATKPTYPPMNPIPAPLSPDIPSFNLIGDSL
SFDFKDTDMKRLSMEIEKEKVEYMEKSKHLQEQLNELKTEIEALKLKERETALDILHNEN
SDRGGSSKHSTIKKGMFLFFFILFCWFSLKPKAEDLSAFEPSNSPCRVPSPEWPSLKSSS
R
Download sequence
Identical sequences ENSNLEP00000004091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]