SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004156 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000004156
Domain Number 1 Region: 465-523
Classification Level Classification E-value
Superfamily UBA-like 1.48e-19
Family CUE domain 0.0000698
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004156   Gene: ENSNLEG00000003429   Transcript: ENSNLET00000004371
Sequence length 617
Comment pep:novel supercontig:Nleu1.0:GL397272.1:2147292:2196129:-1 gene:ENSNLEG00000003429 transcript:ENSNLET00000004371 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPALPLDQLQITHKDPKTRKLRTSPALHPEQKADRYFVLYKPPPKDNIPALVEEYLERAT
FVANDLDWLLALPHDKFWCQVIFDETLQKCLDSYLRYVPRKFDEGVASAPEVVDMQKRLH
RSVFLTFLRMSTHKESKDHFISPSAFGEILYNNFLFDIPKILDLCVLFGKGNSPLLQKMI
GNIFTQQPSYYSDLDETLPTILQVFSNILQHCGLQGDGASTTPQKLEEKGRLTPSDMPLL
ELKDIVLYLCDTCTTLWAFLDIFPLACQTFQKHDFCYRLASFYEAAIPEMESAIKKRRLE
DSKLLGDLWQRLSHSRKKLMEIFHIILNQICLLPILESSCDNIQGFIEEFLQIFSSLLQE
KRFLQDYDALFPVAEDISLLQQASSVLDETRTAYILQAVESAWEGVDRRKAADAKDPTVT
EEPNGEPNRVVVTAEAGSQASSHPENLEEEECMGAAAAVGPAVCGVELDSLISQVKDLLP
DLGEGFILACLEYYHYDPEQVINNILEERLAPTLSQLDRDLDREMKPDPTPLLTSRHNVF
QNDEFDVFSRDSVDLSRVHKGKSTRKEKYTQSLLFDMRAETAQRLRYEQYNVVVEEVPLQ
PGESLPYHIGYYDEYDD
Download sequence
Identical sequences ENSNLEP00000004156 ENSNLEP00000004156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]