SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004247 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000004247
Domain Number 1 Region: 63-162
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 1.7e-38
Family N-terminal domain of cbl (N-cbl) 0.00000935
Further Details:      
 
Domain Number 2 Region: 145-215
Classification Level Classification E-value
Superfamily EF-hand 2.33e-24
Family EF-hand modules in multidomain proteins 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004247   Gene: ENSNLEG00000003523   Transcript: ENSNLET00000004470
Sequence length 227
Comment pep:novel supercontig:Nleu1.0:GL397284.1:12072717:12191970:-1 gene:ENSNLEG00000003523 transcript:ENSNLET00000004470 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALAPGPDVYAHLPPLIELKFQMANSMNGRNPGGRGGNPRKGRILGIIDAIQDAVGPPKQ
AAADRRTVEKTWKLMDKVVRLCQNPKLQLKNSPPYILDILPDTYQHLRLILSKYDDNQKL
AQLSENEYFKIYIDSLMKKSKRAIRLFKEGKERMYEEQSQDRTIVPWKVFRQCLHEVHQI
SSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQVSDNFTEYLIYLT
Download sequence
Identical sequences ENSNLEP00000004247 ENSNLEP00000004247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]