SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004257 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000004257
Domain Number 1 Region: 483-645
Classification Level Classification E-value
Superfamily Cyclophilin-like 2.78e-64
Family Cyclophilin (peptidylprolyl isomerase) 0.0000000372
Further Details:      
 
Domain Number 2 Region: 87-322,353-390
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.83e-34
Family WD40-repeat 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004257   Gene: ENSNLEG00000003475   Transcript: ENSNLET00000004480
Sequence length 646
Comment pep:novel supercontig:Nleu1.0:GL397303.1:10973491:10997265:1 gene:ENSNLEG00000003475 transcript:ENSNLET00000004480 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAESGSDFQQRRRRRRDPEEPEKTEPSERELAVAVAVSQENDEENEERWVGPLPVEATL
AKKRKVLEFERVYLDNLPSASMYERSYMHRDVITHVVCTKTDFIITASHDGHVKFWKKIE
EGIEFVKHFRSHLGVIESIAVSSEGALFCSVGDDKAMKVFDVVNFDMINMLKLGYFPGQC
EWIYCPGDAISSVAASEKSTGKIFIYDGRGDNQPLHIFDKLHTSPLTQIRLNPVYKAVVS
SDKSGMIEYWTGPPHEYKFPKNVNWEYKTDTDLYEFAKCKAYPTSIYFSPDGKKIATIGS
DRKVRIFRFLTGKLMRVFDESLSMFTELQQMRQQLPDMEFGRRMAVERELEKVDAVRLIN
IVFDETGHFVLYGTMLGIKVINVETNRCVRILGKQENIRVMQLALFQGIAKKHRAATTIE
MKASENPVLQNIQADPTIVCTSFKKNRFYMFTKREPEDTKSADSDRDVFNEKPSKEEVMA
ATQAEGPKRVSDSAIIHTSMGDIHTKLFPVECPKTVENFCVHSRNGYYNGHTFHRIIKGF
MIQTGDPTGTGMGGESIWGGEFEDEFHSTLRHDRPYTLSMANAGSNTNGSQFFITVVPTP
WLDNKHTVFGRVTKGMEVVQRISNVKVNPKTDKPYEDVSIINITVK
Download sequence
Identical sequences G1QTI9
ENSNLEP00000004257 ENSNLEP00000004257 XP_003266038.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]