SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004344 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000004344
Domain Number 1 Region: 267-396
Classification Level Classification E-value
Superfamily Second domain of FERM 3.93e-31
Family Second domain of FERM 0.0018
Further Details:      
 
Domain Number 2 Region: 398-503
Classification Level Classification E-value
Superfamily PH domain-like 4.79e-23
Family Third domain of FERM 0.0067
Further Details:      
 
Domain Number 3 Region: 45-138
Classification Level Classification E-value
Superfamily PDZ domain-like 6.26e-16
Family PDZ domain 0.027
Further Details:      
 
Domain Number 4 Region: 180-261
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000474
Family Ras-binding domain, RBD 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004344   Gene: ENSNLEG00000003565   Transcript: ENSNLET00000004571
Sequence length 1577
Comment pep:novel supercontig:Nleu1.0:GL397291.1:20110662:20215137:-1 gene:ENSNLEG00000003565 transcript:ENSNLET00000004571 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEELETSLFQTRKAHRIEQMVARWLRRSRDSSARAKVAAADGPARNPTQTFIPVRHTVKI
DKDTLIQDYGFHISESLPLTVVAVTAGGSAHGKLFPGDQILQMNNEPAEDLSWERAVDIL
REAEDSLSITVVRCTSGVPKSSFLTEEKRARLKTNPVKVHFAEEVLISGHSQGNSLLCMP
NVLKLYLENGQTKAFKFEADTTVKDIILTVKEKLSIRSIEYFALALEEQYSISRLHLLHE
EELIQQVVEREESHDYRCLFRVCFVPKDPLDLLKEDPVAFEYLYLQSCSDVLQERFAVEM
KCSSALRLAALHIQERIYACAQPQKISLKYIEKDWGIENFISPTLLRNMKGKDIKKAISF
HMKRNQNLLEPRQKQLISAAQLRLNYLQILGELKTYGGRIFNATLMLQDRESYIALLVGA
KYGISQIINSKLNIMSTLAEFANISRVELTEESEKVSVVKVYLQDVKVLTLLLESNSAKD
LACLIAGYYRLLVDPVTSIFLWPGNKQQVHRVSAEEGYESRACSDSEESSEVDCVLEPLS
DRRLVKLAPCRSLIKEEQPPGNSPTPEVARRGPSTCGASSTTDSAESEASDSANTESRGY
RTSGSSESMDALEEDDLDTCSSSRSTFFHFGSPGLPESIDSDSQEERSGIETSGFLCLLD
LAQRANPQCQKTEFSESVALETFGWAPELSTVRLDPRLYEGSCADYYSLCSSVSPASYLS
DSSESTASRQAGVPPAWGQQGWTEAQPSSTLEPLALHPPLAFEDGSSDEEYYDAADKLTP
PGPAPGPRDVSAAEPSATSLQNKASTSSPENSLPCGPDGRQPSRRGGVKKYAKTLRKRRS
FLQTDYTSQVSFPLVPSASLESVEDVCYYDREPYLALGAPSPTVSSLQDMQGEPGLLETK
ALGLLAPLRETKSTNPASRVMEMEPETMETKSVIDSRVSSISAIRFRIDPNNKENSDAVP
VASSSASTPHCSNPGSSGPDTAQARPSQILSLSQDLDGTAPKEPTIEHGDSSFSLSSGDP
NPDRAYLASNPGLNNVSQGDTLELQLEPHVQLEMGLESFCTNHIQETASKYTEPLLSPRD
EPRSDECGINPGEKIASIPTKEEQQGQLSLQRDREVANKNGTNIFQEESRKDSGDSPGDV
SNNVSQTLRISSPAGKIVTSLSLDAPVTGTEQIPPRPPRDPQGQSREPPGQGCQAQEQKL
FVELDLDPGCFLGKQTISSALPPEGIKAEAPNHVTGEDIAPRDSPEWVCFNPEPSLPEPL
PCPQEDPHLETSNHCLFSEGKSDSSSICLSAEKSFLCFAPESHPEVSASLRMATSLGFAG
MNEMVAPRIGMDQCSCQFSYATCFRGPQPETEEEDGDLEAHPTAPLTSPPSAGSPVVLPW
RPARPHSCSTAPLSRKSHIWPEYCSRALRQLKATPASTPEGFIQLMESLLELQDILETSW
GIGNKHPPEKCTWHFTESRSRLCMGSQKLLSSCQHVIRMDQSPEEMQGVRDTFQHLVQLA
SLCFQFTDCSRCSARNREAAGNLRDVVYTYHQFVEAAKSTCERGYHDLSVKLLARQCTAL
TAAVFCLTQKFRASTAL
Download sequence
Identical sequences ENSNLEP00000004344 ENSNLEP00000004344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]