SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004358 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000004358
Domain Number 1 Region: 115-209
Classification Level Classification E-value
Superfamily p53-like transcription factors 3.48e-44
Family RUNT domain 0.00000361
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000004358
Domain Number - Region: 13-92
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.000915
Family beta-sandwich domain of Sec23/24 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004358   Gene: ENSNLEG00000003611   Transcript: ENSNLET00000004587
Sequence length 501
Comment pep:novel supercontig:Nleu1.0:GL397304.1:14252291:14379245:-1 gene:ENSNLEG00000003611 transcript:ENSNLET00000004587 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRIPVDPSTSRRFSPPSSSLQPGKMSDVSPVVAAQQQQQQQQQQQQQQQQQQQQQEAAAA
AAAAAAAAAVPRLRPPHDNRTMEPPAGPLPPDALAGSGLSPSAQIPPSPTCARAALPVPG
RVVALGEVPDGTVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLT
ITVFTNPPQVATYHRAIKVTVDGPREPRRHRQKLDDSKPSLFSDRLSDLGRIPHPSMRVG
VPPQNPRPSLNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTTP
LSSTRGTGLPAITDVPRRISDDDTATSDFCLWPSTLSKKSQAGASELGPFSDPRQFPSIS
SLTESRFSNPRMHYPATFTYTPPVTSGMSLGMSATTHYHTYLPPPYPGSSQSQSGPFQTS
STPYLYYGTSSGSYQFPMVPGGDRSPSRMLPPCTTTSNGSTLLNPNLPNQNDGVDADGSH
SSSPTVLNSSGRMDESVWRPY
Download sequence
Identical sequences ENSNLEP00000004358 ENSNLEP00000004358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]