SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004359 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000004359
Domain Number 1 Region: 152-373
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.27e-49
Family DBL homology domain (DH-domain) 0.00037
Further Details:      
 
Domain Number 2 Region: 376-508
Classification Level Classification E-value
Superfamily PH domain-like 4.93e-23
Family Pleckstrin-homology domain (PH domain) 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004359   Gene: ENSNLEG00000003548   Transcript: ENSNLET00000004588
Sequence length 790
Comment pep:novel supercontig:Nleu1.0:GL397358.1:6276188:6293028:1 gene:ENSNLEG00000003548 transcript:ENSNLET00000004588 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAFGPPHEGPLQGLVASRIETYGGRHRASAQSTAGSLYPRGHPVLDPSRRRLQQYVPFA
RGSGQARGLSPMRLRDPEPEKRHGGHVGAGLLHSPKLKEVAKAHELEVRLHTFSMFGMPR
LPPEDRRHWEIGEGGDSGLTIEKSWRELVPGHKEMSRELCHQQEALWELLTTELIYVRKL
KIMTDLLAAGLLNLQRVGLLMEVSAETLFGNVPSLIRTHRSFWEEVLGPTLEETRASGQP
LDPVGLQSGFLTFGQRFHPYVQYCLRVKQTMAYAREQQETNPLFHAFVQWCEKHKRSGRQ
MLCDLLIKPHQRITKYPLLLHAVLKRSPEARAQEALNAMIEAVESFLRHINGQVRQGEEQ
ESLVAAAQRIGPYEVLEPPSDEVEKNLRPFSTLDLTSPMLGVASEHTRQLLLEGPVRVKE
GREGKLDVYLFLFSDVLLVTKPQRKADKAKVIRPPLMLEKLVCQPLRDPNSFLLIHLTEF
QCVSSALLVHCPSPTDRARWLEKTQQAQATLQKLKAEEYVQQKRELLALYRDQDRESPST
RPSTPSLEGSQSSAEGRTPEFSTVIPHLVVTEDTDEDAPFVPDDNSDSGYGTLIPGTPTR
SRSPLSRLRQRALRRDPRLTFSTLDLRDVPLRPHPPNPQAPQRRSAPELPEGILKGGSLP
RGDPPTWSEEEDGASERGNVVVETLHRARLRGQLPSSPAHADSAGESPWESSGEEEDEGP
VFLKAGHTSLRPMRAEDMLREIREELASQRIEGAEEPRDSRPRKLTRAQLQRMRGPHIIQ
LDTPLSTSEV
Download sequence
Identical sequences G1QTU1
ENSNLEP00000004359 XP_003273763.1.23891 ENSNLEP00000004359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]