SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004382 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000004382
Domain Number 1 Region: 421-639
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.76e-57
Family DBL homology domain (DH-domain) 0.0000516
Further Details:      
 
Domain Number 2 Region: 629-778
Classification Level Classification E-value
Superfamily PH domain-like 5.09e-20
Family Pleckstrin-homology domain (PH domain) 0.031
Further Details:      
 
Domain Number 3 Region: 783-849
Classification Level Classification E-value
Superfamily SH3-domain 2.49e-16
Family SH3-domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004382   Gene: ENSNLEG00000003599   Transcript: ENSNLET00000004613
Sequence length 869
Comment pep:novel supercontig:Nleu1.0:GL397268.1:7789004:7933294:1 gene:ENSNLEG00000003599 transcript:ENSNLET00000004613 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGESEVDFSSNSITPLWRRRSIPQPQLLVRSKPRPQSYQSPNGLLITDFPVEDRGTLPA
AQIPAQVPTASDNRTVHGSPLLRGAQRRAVANGGTASPEYRAASPRLRRPKSPKLPKAVP
GGSPKSPANGAVTLPAPPPPVLRPPRTPNAPAPCTPEEDPTGLTASPVPSPTANGLAANN
DSPGSGSQSGQKAKDPERGLPPGPQKSSLEQKLPLQRLPSQENELLENPSVVLSTNSPAA
LKVGKQQIIPKSLASEIKISKSNNQNVEPHKRLLKVRSMVEGLGGPLGHAGEESEVDNDV
DSPGSLRRGLRSTSYRRAVVSGFDFDSPTSSKKKNRMSQPVLKAVMEDKEKFSSLGRIKK
KMLKGQGTFDGEENAVLYQNYKEKALDIDSDEESEPKEQKSDEKIVIHHKPLRSTWSQLS
AVKRNGLSQTVSQEERKRQEAIFEVISSEHSYLLSLEILIRMFKNSKELSDTMTKTERHH
LFSNITDVCEASKKFFIELEARHQNNIFIDDISDIVEKHTASTFDPYVKYCTNEVYQQRT
LQKLLATNPSFKEVLSRIESHEDCRNLPMISFLILPMQRVTRLPLLMDTICQKTPKDSPK
YEVCKRALKEVSKLVRLCNEGARKMERTEMMYTINSQLEFKIKPFPLVSSSRWLVKRGEL
TAYVEDTVLFSRRTSKQQVYFFLFNDVLIITKKKSEESYNVNDYSLRDQLLVESCDNEEL
NSSPGKNSSTMLYSRQSSASHLFTLTVLSNHANEKVEMLLGAETQSERARWITALGHSSG
KPPADRTSLTQVEIVRSFTAKQPDELSLQVADVVLIYQRVSDGWYEGERLRDGERGWFPM
ECAKEITCQATIDKNVERMGRLLGLETNV
Download sequence
Identical sequences A0A2I3GQU8
XP_003256363.1.23891 XP_003256364.1.23891 XP_012366200.1.23891 XP_012366201.1.23891 ENSNLEP00000004382 ENSNLEP00000004382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]