SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004410 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000004410
Domain Number 1 Region: 230-474
Classification Level Classification E-value
Superfamily RNI-like 7.85e-42
Family 28-residue LRR 0.0088
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000004410
Domain Number - Region: 123-159
Classification Level Classification E-value
Superfamily F-box domain 0.00883
Family F-box domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004410   Gene: ENSNLEG00000003668   Transcript: ENSNLET00000004643
Sequence length 500
Comment pep:novel supercontig:Nleu1.0:GL397304.1:15503111:15510369:1 gene:ENSNLEG00000003668 transcript:ENSNLET00000004643 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQDTVTTSALLDPSHSSVSIQDKSSTGGHISSTGPQLSKPSITPVPAKSRNPHPGANFHR
MRRIIAEDPEWSLAIVPLLTELCIQHIIRNFQKNPILKQMLPEHQQKVLNHLSPDLPLAV
TANLIDNENYWLRCCMHRWPVCHVAHHGGSWKRMFFERHLENLLKHFIPGTTDPAVILDL
LPLCRNYVRRVHVDQFLPPVQLPAQLRPGGQSDSGSEGEMEEPTVDHYQLGDLVAGLSHL
EELDLVYDVKDCGMNFEISFLFTYRDCXXXXXCYRLSACPQIFKLTRSKVDDDKARIIIR
SLLDHPVLEELDLSQNLIGDRGARGAAKLLSHSRLRVLNLANNQVRAPGAQSLAHTLAHN
ANLISLNLRLNCIKDEGGQALAHALQTNKCLTTLHLGGNELSEPTATLLSQVLAINTTLT
SINLSCNHIGLDGGKQLLEGMSDNKTLLEFDLRLSDVAQESEYLIGQALHANREAARQRA
LNPSHFMSTITANGPENSMG
Download sequence
Identical sequences ENSNLEP00000004410 ENSNLEP00000004410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]