SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004706 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000004706
Domain Number 1 Region: 298-361
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0000000288
Family beta-sandwich domain of Sec23/24 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004706   Gene: ENSNLEG00000003872   Transcript: ENSNLET00000004948
Sequence length 587
Comment pep:novel supercontig:Nleu1.0:GL397315.1:13695866:13736220:1 gene:ENSNLEG00000003872 transcript:ENSNLET00000004948 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFYLDLTLFHRAEETGEESFSVQNGSIHQKDAVNDDDFEPYLSSQTNQSNSYPPMSDPYM
PSYYAPSIGFPYSLGEAAWSTAGDQPMPYLTTYGQMSNGEHHYIPDGVFSQPGALGNTPP
FLGQHGFNFFPGNADFSTWGTSGSQGQSTQSSAYSSSYGYPPSSLGRAITDGQAGFGNDT
LSKVPGISSIEQGMTGLKIGGDLTAAVTKTVGTALSSSGMTSIATNSVPPVSSAAPKPTS
WAAIARKPAKPQPKLKPKGNVGIGGSAVPPPPIKHNMNIGTWDEKGSVVKAPPTQPVLPP
QTIIQQPQPLIQPPPLVQSQLPQQQPQPPQPQQQQGPQPQAQPHQVQPQQQQLQNRWVAP
RNRGAGFNQNNGAGSENFGLGVVPVSASPSSVEVHPVLEKLKAINNYNPKDFDWNLKNGR
VFIIKSYSEDDIHRSIYSIWCSTEHGNKRLDAAYRSLNGKGPLYLLFSVNGSGHFCGVAE
MKSVVDYNAYAGVWSQDKWKGKFEVKWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEV
PLEKAKQVLKIIATFKHTTSIFDDFAHYEKRQEEEEAMRRERNRNKQ
Download sequence
Identical sequences A0A2I3GWH2
ENSNLEP00000004706

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]