SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004711 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000004711
Domain Number 1 Region: 77-272
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 1.26e-57
Family CRAL/TRIO domain 0.0000000361
Further Details:      
 
Domain Number 2 Region: 277-387
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 4.84e-37
Family Supernatant protein factor (SPF), C-terminal domain 0.000000923
Further Details:      
 
Domain Number 3 Region: 2-74
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 1.14e-21
Family CRAL/TRIO N-terminal domain 0.000022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004711   Gene: ENSNLEG00000003867   Transcript: ENSNLET00000004954
Sequence length 400
Comment pep:novel supercontig:Nleu1.0:GL397272.1:2826022:2839066:-1 gene:ENSNLEG00000003867 transcript:ENSNLET00000004954 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGRVGDLSPKQAETLAKFRENVQDVLPALPNPDDYFLLRWLRARNFDLQKSEAMLCKYM
EFRKTMDIDHILDWQPPEVIQKYMPGGLCGYDRDGCPVWYDIIGPLDPKGLLFSVTKQDL
LKTKMRDCERILHECDLQTQRLGKKIETIVMIFDCEGLGLKHFWKPLVEVYQEFFGLLEE
NYPETLKFMLIVKATKLFPVGYNLMKPFLSEDTRRKIIVLGNNWKEGLLKLISPEELPAQ
FGGTLTDPDGNPKCLTKINYGGEIPKSMYVRDQVKTQYEHSVQINRGSSHQVEYEILFPG
CVLRWQFSSDGADIGFGVFLKTKMGERQRAGEMTEVLPSQRYNAHMVPEDGSLTCLEAGV
YVLRFDNTYSFVHAKKVSFTVEVLLPDEGMQKYDKELTPV
Download sequence
Identical sequences G1QUU1
ENSNLEP00000004711 XP_003258123.1.23891 ENSNLEP00000004711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]