SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004873 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000004873
Domain Number 1 Region: 3-164
Classification Level Classification E-value
Superfamily Cyclophilin-like 9.55e-137
Family Cyclophilin (peptidylprolyl isomerase) 0.0000331
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004873   Gene: ENSNLEG00000004024   Transcript: ENSNLET00000005124
Sequence length 165
Comment pep:known supercontig:Nleu1.0:GL397320.1:9516694:9521317:1 gene:ENSNLEG00000004024 transcript:ENSNLET00000005124 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGF
MCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTE
WLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE
Download sequence
Identical sequences A0A248QF42 A0A248QF48 A0A248QF50 A0A248QF86 A0A248QF87 A0A248QF92 A0A248QFA4 A0A248QFA5 A0A248QFD4 A0A248QFD6 A0A248QIH0 A0A248QK93 A0A286QUM5 A0A286QUN3 A0A286QUP5 A0A286QUP8 A0A286QUQ0 A0A2J8L9E7 A0A2J8SSX7 A0A2K6LJW7 A0A2K6NI12 G7NKM4 G7PWP2 P62937 P62938 P62940 P62941 Q0ZQK6 Q0ZQK7 Q0ZQK8 Q0ZQL0 Q0ZQL1 Q0ZQL2 Q5R8S7 V9HWF5
ENSP00000419425 ENSPTRP00000042839 ENSMMUP00000021879 ENSMMUP00000021879 1ak4_A 1ak4_B 1bck_A 1cwa_A 1cwb_A 1cwc_A 1cwf_A 1cwh_A 1cwi_A 1cwj_A 1cwk_A 1cwl_A 1cwm_A 1cwo_A 1fgl_A 1m63_C 1m63_G 1m9c_A 1m9c_B 1m9d_A 1m9d_B 1m9f_A 1m9f_B 1m9x_A 1m9x_B 1m9x_E 1m9x_F 1m9y_A 1m9y_B 1m9y_E 1m9y_F 1mf8_C 1mik_A 1nmk_A 1nmk_B 1oca_A 1vbs_A 1vbt_A 1vbt_B 1w8l_A 1w8m_A 1w8v_A 1ynd_A 1ynd_B 1zkf_A 1zkf_B 2cpl_A 2ms4_A 2mzu_A 2n0t_A 2rma_A 2rma_C 2rma_E 2rma_G 2rma_I 2rma_K 2rma_M 2rma_O 2rma_Q 2rma_S 2rmb_A 2rmb_C 2rmb_E 2rmb_G 2rmb_I 2rmb_K 2rmb_M 2rmb_O 2rmb_Q 2rmb_S 2x2c_K 2x2c_M 2x2c_O 2x2c_Q 2x2c_S 2x2d_B 2x2d_C 3cys_A 3k0m_A 3k0n_A 3odi_A 3odi_C 3odi_E 3odi_G 3odi_I 3odi_K 3odi_M 3odi_O 3odi_Q 3odi_S 3odl_A 3odl_C 3odl_E 3odl_G 3odl_I 3odl_K 3odl_M 3odl_O 3odl_Q 3odl_S 4ipz_A 4n1n_A 4n1o_A 4n1p_A 4n1q_A 4n1r_A 4n1s_A 4yug_A 4yuh_A 4yui_A 4yuj_A 4yuk_A 4yul_A 4yum_A 4yun_A 4yuo_A 4yup_A 5f66_A 5lud_A 5noq_A 5nor_A 5nos_A 5not_A 5nou_A 5nov_A 5now_A 5nox_A 5noy_A 5noz_A 9544.ENSMMUP00000021879 9598.ENSPTRP00000042839 9606.ENSP00000419425 ENSPTRP00000042839 ENSGGOP00000019965 ENSGGOP00000019965 NP_001027981.1.72884 NP_001271703.1.63531 NP_066953.1.87134 NP_066953.1.92137 XP_003268926.1.23891 XP_003268937.1.23891 XP_004062662.2.27298 XP_005550712.1.63531 XP_007979609.1.81039 XP_008000443.1.81039 XP_008967123.1.60992 XP_010352537.1.97406 XP_010354170.1.97406 XP_010356638.1.97406 XP_010357907.1.97406 XP_010366215.1.97406 XP_010368612.1.97406 XP_010369219.1.97406 XP_010372881.1.97406 XP_010374510.1.97406 XP_010374583.1.97406 XP_010374937.1.97406 XP_010379196.1.97406 XP_010383665.1.97406 XP_010385213.1.97406 XP_011788735.1.43180 XP_011814795.1.43180 XP_017702788.1.44346 XP_017709203.1.44346 XP_017712586.1.44346 XP_017718721.1.44346 XP_017720158.1.44346 XP_017727082.1.44346 XP_017727152.1.44346 XP_017730529.1.44346 XP_017736958.1.44346 XP_017738545.1.44346 XP_017740397.1.44346 XP_017741250.1.44346 XP_017743181.1.44346 XP_017744169.1.44346 XP_018886247.1.27298 gi|10863927|ref|NP_066953.1| ENSNLEP00000004873 ENSP00000394670 ENSP00000419425 ENSPANP00000011969 1w8mA 000140664|e2xgyB1|75.1.1.6|B:9-173 000387372|e2x2cK1|75.1.1.6|K:1-165 000387373|e2x2cM1|75.1.1.6|M:1-165 000387374|e2x2cO1|75.1.1.6|O:1-165 000387375|e2x2cQ1|75.1.1.6|Q:1-165 000387376|e2x2cS1|75.1.1.6|S:1-165 000387377|e2x2dB1|75.1.1.6|B:1-165 000412923|e3odiA1|75.1.1.6|A:1-165 000412925|e3odiE1|75.1.1.6|E:1-165 000412926|e3odiG1|75.1.1.6|G:1-165 000412929|e3odiM1|75.1.1.6|M:1-165 000412930|e3odiO1|75.1.1.6|O:1-165 000412933|e3odlA1|75.1.1.6|A:1-165 000412934|e3odlC1|75.1.1.6|C:1-165 000412935|e3odlE1|75.1.1.6|E:1-165 000412936|e3odlG1|75.1.1.6|G:1-165 000412937|e3odlI1|75.1.1.6|I:1-165 000412938|e3odlK1|75.1.1.6|K:1-165 000412939|e3odlM1|75.1.1.6|M:1-165 000412940|e3odlO1|75.1.1.6|O:1-165 000412941|e3odlQ1|75.1.1.6|Q:1-165 000412942|e3odlS1|75.1.1.6|S:1-165 001548171|e2mzuA1|75.1.1.6|A:1-165 001678062|e4n1nA1|75.1.1.6|A:1-165 001678063|e4n1oA1|75.1.1.6|A:1-165 001678064|e4n1pA1|75.1.1.6|A:1-165 001678065|e4n1qA1|75.1.1.6|A:1-165 001678066|e4n1rA1|75.1.1.6|A:1-165 001678067|e4n1sA1|75.1.1.6|A:1-165 001680501|e2n0tA1|75.1.1.6|A:1-165 001684088|e2ms4A1|75.1.1.6|A:1-165 001697411|e4yugA1|75.1.1.6|A:1-165 002055511|e5ludA1|75.1.1.6|A:1-165 002092967|e5noqA1|75.1.1.6|A:1-165 002092968|e5norA1|75.1.1.6|A:1-165 002092969|e5nosA1|75.1.1.6|A:1-165 002092970|e5notA1|75.1.1.6|A:1-165 002092971|e5nouA1|75.1.1.6|A:1-165 002092972|e5novA1|75.1.1.6|A:1-165 002092973|e5nowA1|75.1.1.6|A:1-165 002092974|e5noxA1|75.1.1.6|A:1-165 002092975|e5noyA1|75.1.1.6|A:1-165 002092976|e5nozA1|75.1.1.6|A:1-165 cath|current|1ak4A00/1-165 cath|current|1ak4B00/3-165 cath|current|1bckA00/1-165 cath|current|1cwaA00/1-165 cath|current|1cwbA00/1-165 cath|current|1cwcA00/1-165 cath|current|1cwfA00/1-165 cath|current|1cwhA00/1-165 cath|current|1cwiA00/1-165 cath|current|1cwjA00/1-165 cath|current|1cwkA00/1-165 cath|current|1cwlA00/1-165 cath|current|1cwmA00/1-165 cath|current|1cwoA00/1-165 cath|current|1fglA00/1-165 cath|current|1m63C00/1-165 cath|current|1m63G00/1-165 cath|current|1m9cA00/1-165 cath|current|1m9cB00/3-165 cath|current|1m9dA00/1-165 cath|current|1m9dB00/3-165 cath|current|1m9fA00/1-165 cath|current|1m9fB00/2-165 cath|current|1m9xA00/1-165 cath|current|1m9xB00/2-165 cath|current|1m9xE00/1-165 cath|current|1m9xF00/2-165 cath|current|1m9yA00/1-165 cath|current|1m9yB00/2-165 cath|current|1m9yE00/1-165 cath|current|1m9yF00/2-165 cath|current|1mf8C00/1-164 cath|current|1mikA00/1-165 cath|current|1nmkA00/1-165 cath|current|1nmkB00/1-165 cath|current|1ocaA00/1-165 cath|current|1vbsA00/2-165 cath|current|1vbtA00/2-165 cath|current|1vbtB00/2-165 cath|current|1w8lA00/1-165 cath|current|1w8mA00/1-165 cath|current|1w8vA00/1-165 cath|current|1yndA00/2-165 cath|current|1yndB00/2-165 cath|current|1zkfA00/1-165 cath|current|1zkfB00/2-165 cath|current|2cplA00/2-165 cath|current|2rmaA00/1-165 cath|current|2rmaC00/1-165 cath|current|2rmaE00/1-165 cath|current|2rmaG00/1-165 cath|current|2rmaI00/1-165 cath|current|2rmaK00/1-165 cath|current|2rmaM00/1-165 cath|current|2rmaO00/1-165 cath|current|2rmaQ00/1-165 cath|current|2rmaS00/1-165 cath|current|2rmbA00/1-165 cath|current|2rmbC00/1-165 cath|current|2rmbE00/1-165 cath|current|2rmbG00/1-165 cath|current|2rmbI00/1-165 cath|current|2rmbK00/1-165 cath|current|2rmbM00/1-165 cath|current|2rmbO00/1-165 cath|current|2rmbQ00/1-165 cath|current|2rmbS00/1-165 cath|current|3cysA00/1-165 d1ak4a_ d1bcka_ d1cwaa_ d1cwba_ d1cwca_ d1cwfa_ d1cwha_ d1cwia_ d1cwja_ d1cwka_ d1cwla_ d1cwma_ d1cwoa_ d1fgla_ d1m63c_ d1m63g_ d1m9ca_ d1m9da_ d1m9fa_ d1m9xa_ d1m9xe_ d1m9ya_ d1m9ye_ d1mika_ d1nmka_ d1nmkb_ d1ocaa_ d1w8la_ d1w8ma_ d1w8va_ d1zkfa_ d2ms4a_ d2mzua_ d2n0ta_ d2rmaa_ d2rmac_ d2rmae_ d2rmag_ d2rmai_ d2rmak_ d2rmam_ d2rmao_ d2rmaq_ d2rmas_ d2rmba_ d2rmbc_ d2rmbe_ d2rmbg_ d2rmbi_ d2rmbk_ d2rmbm_ d2rmbo_ d2rmbq_ d2rmbs_ d2x2db_ d2xgyb_ d3cysa_ d4n1ma1 d4n1na_ d4n1oa_ d4n1pa_ d4n1qa_ d4n1ra_ d4n1sa_ d4yuga_ d5luda_ d5noqa_ d5nora_ d5nosa_ d5nota_ d5noua_ d5nova_ d5nowa_ d5noxa_ d5noya_ d5noza_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]