SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004941 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000004941
Domain Number 1 Region: 6-255
Classification Level Classification E-value
Superfamily RNI-like 4.87e-39
Family 28-residue LRR 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004941   Gene: ENSNLEG00000004080   Transcript: ENSNLET00000005197
Sequence length 316
Comment pep:novel supercontig:Nleu1.0:GL397304.1:16308605:16311400:1 gene:ENSNLEG00000004080 transcript:ENSNLET00000005197 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPSSIQISGEPLSGAEVRDICRGLRDNAVRLLSLRGCRLCDRDFGRICRALAGATSLAQ
LNLNLGVVSSPSRIKQLAEALRTNRSIQSLFLHGSPLTDAGLALLNPALALHPALVALDL
GDCMLGDEAINLICGLLPPDGAKSGLKELTLSANPGITPKGWSRLAIAVAHSSQVRVLNL
DYNPLGDHVAGMLAVAVASSRTLEVLDLEGTGLTNQSAQXXXXXXXNYPTALRSLVLAEN
SISPELQQQICDLLSEGEEEEEVAGGAGDTQEWERGREPAANQRGSSSWMCPSDPSSQMV
LMTSGLGDSLLAETEM
Download sequence
Identical sequences ENSNLEP00000004941 ENSNLEP00000004941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]