SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004951 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000004951
Domain Number - Region: 467-526
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0392
Family beta-sandwich domain of Sec23/24 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004951   Gene: ENSNLEG00000004068   Transcript: ENSNLET00000005207
Sequence length 718
Comment pep:novel supercontig:Nleu1.0:GL397292.1:15657774:15665978:1 gene:ENSNLEG00000004068 transcript:ENSNLET00000005207 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVAVRTLQEQLEKAKESLKNVDENIRKLTGRDPNDVRPIQARLLALSGPGGGRGRGSLL
LRRGFSDSGGGPPAKQRDLEGAVSRLGGERRTRRESRQESDPEDDDVKKPALQSSVVATS
KERTRRDLIQDQNMDEKGKQRNRRIFGLLMGTLQKFKQESTVATERQKRRQEIEQKLEVQ
AEEERKQVENERRELFEERRAKQTELRLLEQKVELAQLQEEWNEHNAKIIKYIRTKTKPH
LFYIPGRMCPATQKLIEESQRKMNALFEGRRIEFAEQINKMEARPRRQSMKEKEHQVVRN
EEQKAEQEEGKVAQREEELEETGNQHNDVEIEEAGEEEEKEIAIVHSDAEKEQEEEEQKQ
EMEVKMEEETEVRESEKQQDSQPEEVMDVLEMVENVKHVIADQEVMETDRVESVEPSENE
ASKELEPEMEFEIEPDKECKSLSPGKENVSALDMEKESEEKEKESEPQPEPVAQPQPQPQ
HQPQLQLQSQSQPVLQSQPPSQPENLSLAVLQPTPQVTQEQGHLLPERKEFPVESVKLTE
VPVEPVLTVHPESKSKTKTRSRSRGRARNKTSKSRSRSSSSSSSSSSSTSSSSGSSSSSG
SSSSRSSSSSSSSTSGSSSRDSSSSTSSSSESRSRSRGRGHNRDRKHRRSVDRKRRDTSG
LERSHKSSKGGSSRDTKGSKDKNSRSDRKRSISESSRSGKRSSRSERDRKSDRKDKRR
Download sequence
Identical sequences G1QVI0
XP_003263778.1.23891 ENSNLEP00000004951 ENSNLEP00000004951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]