SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004964 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000004964
Domain Number - Region: 62-86
Classification Level Classification E-value
Superfamily Cyclophilin-like 0.0624
Family Cyclophilin (peptidylprolyl isomerase) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004964   Gene: ENSNLEG00000004104   Transcript: ENSNLET00000005221
Sequence length 345
Comment pep:novel supercontig:Nleu1.0:GL397313.1:7674080:7868125:1 gene:ENSNLEG00000004104 transcript:ENSNLET00000005221 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVALLTLPAVTSDSWYIGALGARVICDNIPGLVSRQRQLCQRYPDIMRSVGEGAREWIRE
CQHQFRHHRWNCTTLDRDHTVFGRVMLRSSREAAFVYAISSAGVVHAITRACSQGELSVC
SCDPYTRGRHHDQRGDFDWGGCSDNIHYGVRFAKAFVDAKEKRLKDARALMNLHNNRCGR
TAVRRFLKLECKCHGVSGSCTLRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTA
ARQGYRRATRTDLVYFDNSPDYCVLDKAAGSLGTAGRVCSKTSKGTDGCEIMCCGRGYDT
TRVTRVTQCECKFHWCCAVRCRDCRNTVDVHTCKGPQKAEWLDQT
Download sequence
Identical sequences ENSNLEP00000004964 ENSNLEP00000004964

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]