SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005091 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005091
Domain Number 1 Region: 3-219
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.58e-64
Family DBL homology domain (DH-domain) 0.00000000228
Further Details:      
 
Domain Number 2 Region: 219-359
Classification Level Classification E-value
Superfamily PH domain-like 1.54e-33
Family Pleckstrin-homology domain (PH domain) 0.000000201
Further Details:      
 
Domain Number 3 Region: 373-493
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.61e-27
Family PLC-like (P variant) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005091   Gene: ENSNLEG00000004204   Transcript: ENSNLET00000005351
Sequence length 500
Comment pep:novel supercontig:Nleu1.0:GL397293.1:19407707:19436902:1 gene:ENSNLEG00000004204 transcript:ENSNLET00000005351 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CSDLHLLDMLTPTERKRQGYIHELIVTEENYVNDLQLVTEIFQKPLMESELLTEKEVAMI
FVNWKELIMCNIKLLKALRVRKKMSGEKMPVKMIGDILSAQLPHMQPYIRFCSRQLNGAA
LIQQKTDEAPDFKEFVKRLAMDPRCKGMPLSSFILKPMQRVTRYPLIIKNILENTPENHP
DHSHLKHALEKAEELCSQVNEGVREKENSDRLEWIQAHVQCEGLSEQLVFNSVTNCLGPR
KFLHSGKLYKAKSNKELYGFLFNDFLLLTQITKPLGSSGTDKVFSPKSNLQYKMYKTPIF
LNEVLVKLPTDPSGDEPIFHISHIDRVYTLRAESINERTAWVQKIKAASELYIETEKKKR
EKAYLVRSQRATGIGRLMVNVVEGIELKPCRSHGKSNPYCEVTMGSQCHITKTIQDTLNP
KWNSNCQFFIRDLEQEVLCITVFERDQFSPDDFLGRTEIRVADIKKDQGSKGPVTKCLLL
HEVPTGEIVVRLDLQLFDEP
Download sequence
Identical sequences ENSNLEP00000005091 ENSNLEP00000005091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]