SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005176 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005176
Domain Number 1 Region: 68-135
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000157
Family F-box domain 0.003
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000005176
Domain Number - Region: 197-353
Classification Level Classification E-value
Superfamily RNI-like 0.00133
Family 28-residue LRR 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005176   Gene: ENSNLEG00000004272   Transcript: ENSNLET00000005442
Sequence length 555
Comment pep:novel supercontig:Nleu1.0:GL397292.1:15865901:15902042:-1 gene:ENSNLEG00000004272 transcript:ENSNLET00000005442 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLFLSVPQPRPPGARTRAGAARVARWRRLRLQQLRRLRGLLRVLRGRPGAGSRRRGRMA
LCGQAAGAASLPSELIVHIFSFLPAPDRLRASASCSHWRECLFYPALWPQLRICLRVSPA
EQPRLEFLMRKCGWFVRELRVEFAAENYLSGGGPGDGGGADTGTGGEEVEALQLSARWLE
VLRTYLELVLCVLVSIRNNRNLQKFSLFGDISVLQQQGSLSNTYLSKVDPDGKKIKQIQQ
LFEEILSNSRQLKWLSCGFMLEIVTPTSLSSLSNAVANTMEHLSLLDNNIPGNSTLITAV
ELERFVNLHSLALDFCDFTAEIARVLTDSNHVPLQRLSLLVHNVSVMHKSLDNMPNDEHW
KALSRKSTSLRVYIMAFDIKSEDMLKILKPSIPLERIHFDSYITCVSGAIVDLISRQYDK
FLTHFILMNDVIDTSGFPDLSDNRNEDPLVLLAWRCTKLSLLAIHGYTVWAHNLIAIARL
RGSDLKVLEVTEESIDFDQGELADQDVDPVHNLIEQVSLGLGQPWHAVMDIESLSVFTEP
NRHFYREMQSFSEDI
Download sequence
Identical sequences G1QW55
XP_003263786.1.23891 ENSNLEP00000005176 ENSNLEP00000005176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]