SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005237 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000005237
Domain Number - Region: 286-337
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00046
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005237   Gene: ENSNLEG00000004332   Transcript: ENSNLET00000005510
Sequence length 341
Comment pep:novel supercontig:Nleu1.0:GL397308.1:18052978:18070866:1 gene:ENSNLEG00000004332 transcript:ENSNLET00000005510 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNCNFQKHAPLEEFYSFGESMCEYFGHRGSKQLHRGKPVRLGYKIWCGTTSRGYLVWFEP
SQGTLFTKPDRSLDLGGSMVIKFVDALQERGFLPYHIFFDKVFTSVKLMSILRKKGVKAT
GTVREYRTERCPLKDPKELKKMKRGSFDYKVDESEEIIVCRWRDSSVVNICSNAVGIEPV
RLTSRHSGATKTRTQVHQPSLVKLYQEKVGGVGRMDQNIAKYKVKIRGMKWYSSFIGYVI
DAALNNAWQLHRICCQDAQVDLLAFRRYIACVYLESNADTTSQGRRSRRLETESRFDMIG
HWIIHQDKRTRCALCHSQTNTRCEKCQKGVHAKCFREYHIR
Download sequence
Identical sequences XP_004088058.1.23891 ENSNLEP00000005237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]