SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005242 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005242
Domain Number 1 Region: 7-60
Classification Level Classification E-value
Superfamily F-box domain 0.00000000011
Family F-box domain 0.0056
Further Details:      
 
Domain Number 2 Region: 129-212
Classification Level Classification E-value
Superfamily RNI-like 0.0000000294
Family Rna1p (RanGAP1), N-terminal domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005242   Gene: ENSNLEG00000004335   Transcript: ENSNLET00000005515
Sequence length 374
Comment pep:novel supercontig:Nleu1.0:GL397289.1:19822261:19827410:1 gene:ENSNLEG00000004335 transcript:ENSNLET00000005515 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEPGEGLPEEVLALIFRHLPLRDRAAAARVCRAWAAAVTCSAVWHDTKISCECELEGML
PPYLSVCLDHVHNLRLEFEPSRKPSRRAAIELLMALAGRALGLRGLRLECRGEKPLFDAG
RDVLEAVHAVCGAASQLRHLDLRRLPFTLDDALVLQAARSCPELQSLFLDNSTLVGSVGP
GSVLELLEACPRLRALGLHLASLSHAILEALAAPDRAPFALLALRCACPEDARAPPLPNE
AWIALRRRHPGLAVELELEPALPAESVTRVLQPAVPVAALRLNLSGDTVGPVRFAAHHYA
ATLCALEVRAAASAELNAALQELAARCAALSEVHCFCVVSHSVLDAFRAHCPRLRTYTLK
LTREPHPWRPTLVA
Download sequence
Identical sequences ENSNLEP00000005242 ENSNLEP00000005242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]