SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005279 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005279
Domain Number 1 Region: 10-214
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.28e-43
Family DBL homology domain (DH-domain) 0.00038
Further Details:      
 
Domain Number 2 Region: 202-334
Classification Level Classification E-value
Superfamily PH domain-like 7.95e-17
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005279   Gene: ENSNLEG00000004351   Transcript: ENSNLET00000005554
Sequence length 335
Comment pep:novel supercontig:Nleu1.0:GL397291.1:22285771:22289579:1 gene:ENSNLEG00000004351 transcript:ENSNLET00000005554 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEISCPGARCPVQEQRARWERKRACTARELLETEWRYQEQLGLVATYFLGILKAKGTLRP
PERQALFGSWELIYGASQELLPYLEGGCWGQGLEGFCRHLELYNQFAANSERSQTTLQEQ
LKKNKGFRRFVRLQEGRPEFGGLQLQDLLPLPLQRLQQYENLVVALAENTGPNSPDHQQL
TRAARLISETAQRVHTIGQKQKNDQHLRRVQALLSGRQAKGLTSGRWFLRQGWLLVVPPH
GEPRPRMFFLFTDVLLMAKPRPPLHLLRSGTFACKALYPMTQCHLSRVFGHSGGPCGGLL
SLSFPHEKLLLMSTDQEELSRWYHSLTWAISSQKN
Download sequence
Identical sequences G1QWF8
ENSNLEP00000005279 ENSNLEP00000005279 XP_003263409.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]