SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005335 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005335
Domain Number 1 Region: 56-226
Classification Level Classification E-value
Superfamily vWA-like 3.66e-18
Family Integrin A (or I) domain 0.025
Further Details:      
 
Domain Number 2 Region: 323-385
Classification Level Classification E-value
Superfamily Cysteine-rich domain 7.01e-17
Family TFIIH p44 subunit cysteine-rich domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005335   Gene: ENSNLEG00000004315   Transcript: ENSNLET00000005612
Sequence length 395
Comment pep:novel supercontig:Nleu1.0:GL397303.1:15000283:15033552:1 gene:ENSNLEG00000004315 transcript:ENSNLET00000005612 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEEPERTKRWEGGYERTWEILKEDESGSLKATIEDILFKAKRKRVFEHHGQVRLGMMRH
LYVVVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTEL
SGNPRKHITSLKKAVDMTCHGEPSLYNSLSMAMQTLKHMPGHTSREVLIIFSSLTTCDPS
NIYDLIKTLKAAKIRVSVIGLSAEVRVCTVLARETGGTYHVILDESHYKELLTHHVSPPP
ASSSSECSLIRMGFPQHTNASLSDQDAKPSFSMAHLDGNTEPGLTLGGYFCPQCRAKYCE
LPVECKICGLTLVSAPHLARSYHHLFPLDAFQEILLEEHNGERFCYGCQGELKDQHVYVC
AVCQNVFCVDCDVFVHDSLHCCPGCIHKIPASSGV
Download sequence
Identical sequences G1QWL4
ENSNLEP00000005335 ENSNLEP00000005335 XP_003266076.1.23891 XP_012352711.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]