SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005378 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005378
Domain Number 1 Region: 153-242
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 1.96e-33
Family Inhibitor of apoptosis (IAP) repeat 0.0000997
Further Details:      
 
Domain Number 2 Region: 259-365
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 2.49e-30
Family Inhibitor of apoptosis (IAP) repeat 0.00021
Further Details:      
 
Domain Number 3 Region: 1048-1388
Classification Level Classification E-value
Superfamily RNI-like 6.67e-26
Family Cyclin A/CDK2-associated p19, Skp2 0.014
Further Details:      
 
Domain Number 4 Region: 47-135
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 1.3e-24
Family Inhibitor of apoptosis (IAP) repeat 0.00072
Further Details:      
 
Domain Number 5 Region: 463-653
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000341
Family RecA protein-like (ATPase-domain) 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005378   Gene: ENSNLEG00000004412   Transcript: ENSNLET00000005657
Sequence length 1399
Comment pep:novel supercontig:Nleu1.0:GL397303.1:15046500:15103144:1 gene:ENSNLEG00000004412 transcript:ENSNLET00000005657 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATQQKASDERISQFDHDLLPELSALLGLDAVQFVMEIEEEEQKERAKMRKGYNSQMRSE
AKRLKTFVTYEPYSSWIPQEMAAAGFYFTGVKSGVQCFCCSLILFGASLSRLPIEDHKRF
HPDCGFLLNKDVGNIAKYDIRVKNLKSRLRGGKMRYQEEEARLASFRNWPFYVQGISPCV
LSEAGFVFTGKQDTVQCFSCGGCLGNWEEGDDPWKEHAKWFPKCEFLQSKKSSEEITQYI
QSYKGFVDVTGEHFVNSWVQRELPMASAYCNDSIFAYEELRLDSFKDWPRESAVGVAALA
KAGLFYTGIKDVVQCFSCGGCLEKWQEGDDPLDDHARCFPKCPFLQNMKSSAEVIPDLQS
RGELCELLETTSESNLEDSIAVDPIVPEMAQDEAQWFQEAKNLNEQLRAAYTSASFRRMS
LLDISSDLATDHLLGCDLSIASKHISKPVEEPLVLPEVFANLNSVMCVEGEAGSGKTVLL
KKIAFLWASGCCPLLNRFQLVFYLSFSSTRPDQGLASIICDQLLEKEGSVTEMCMRNILQ
QLKDVLFLLDDYKEICSIPQVIGKLIQKNHLSRTCLLIAVRTDRARDIRRYLETILEIKA
FPFYNTVFILRKLFAHNMTRLQKFMVYFRKNESLQKIQKTPLFVAAVCAHWFQYPFDPSF
DDVAIFKSYMERLFLATAELLKATVSSCGELALKGFFSCCFEFNDDDLAEAGVDEDEDLT
MCLMSKFTAQRLRPFYQFLSPAFQEFLAGMRLIELLDSDRQEHQDLGLYYLKQINSPMMT
VSAYNNFLNYVSSLPSTKAGPKIVSHLLHLVDNKESLENISENDDYLKHQPEISLKMQLL
RGLWQICPQTYFSMVSEHLLVLALKIAYQSNTVAACSPFVLQFLQGRTLTLGALNLQYFF
DHPESLSLLRSIHFSIRGNKTSPRAHFSVLETCFDKSQIPTIDQDYASAFEPMNEWERNL
AEKEDNVKSYMDMQRRASPDLSTGYWKLSPKQYKIPCLEVDVNDIDAVDQEMLEILMTVF
SASQHIELHVNHSRGFTESIRPALELSKASVTKCSISKLELSAAEQELLLTLPSLESLEV
SGTIQSQDQIFPNLDKFLCLKELSVDLEGKINVFSVIPEEFPNFHHMEKLLIKISAEYDP
SKLVKLIQNSPNLHVFHLKCNFFSDFESLMTILASCKKLSEIKFSDSFFQAVPFVAILPN
FISLKILNLEGQQFPDEEISEKFAYILGSLSNLEELILPTGDGIYRVAKLIIQQCQQLHC
LRVLSFFKTLNDDSVVEIAKVAISGGFQKLENLKLSINHKITEEGYRNFFQALDNMPNLH
ELDISRHFTECIKAQASTVKSLSQCVLRLPRLIRLNMLSWLLDADDIALLNVMKERHPQS
KYLTILQKWILPFSPIIQK
Download sequence
Identical sequences ENSNLEP00000005378 ENSNLEP00000005378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]