SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005567 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005567
Domain Number 1 Region: 734-909
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.06e-41
Family DBL homology domain (DH-domain) 0.0000923
Further Details:      
 
Domain Number 2 Region: 919-1034
Classification Level Classification E-value
Superfamily PH domain-like 1.17e-34
Family Pleckstrin-homology domain (PH domain) 0.0009
Further Details:      
 
Domain Number 3 Region: 185-331
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00000693
Family CRAL/TRIO domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005567   Gene: ENSNLEG00000004488   Transcript: ENSNLET00000005854
Sequence length 1192
Comment pep:novel supercontig:Nleu1.0:GL397289.1:19948186:19960346:1 gene:ENSNLEG00000004488 transcript:ENSNLET00000005854 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERPLENGDESPDSQGHATDWRFAVCSFRDAWEEEEPASQMHVKDPGPPRPPARATQDEE
LQGSPLSRKLQLPPAADESGDAQRGTVESSSVLSEGPGPSGVESLLCPMSSHLSLAQGES
DTPGVGLVGDPGPSRVMPSGLSPGALDSDPVGLGDPLSETSSKLLEAAPSGSGLPKPADC
LLAQDLCWELLASGMATLPGTRDVQGRAVLLLCAHSPAWLQSECSSQELIRLLLYLRSIP
RPEVQALGLTVLVDARICSPSSSLFSGLSQLQEAAPGAVYQVLLVGSTLLKEVPSGLQLE
QLPSQSLLTHIPMAGLPTSLGGGLPYCHQAWLDFRRRLEALLENCQAACALLQGAIESVK
AVPQPMEPGEVGRLLQQTEVLMQQVLDSPRLAWLQCQGGRELTWLKQEVPEVTLSPDYRT
AMDKADKLYDRVDGLLHQLTLQSNQRIQALELVQTLGAREGGLHQIEVWLQQVGWPALEE
PGELSLDMLLQAQGSFRELYQVAQEQVRQGEKFLQPLTGWEAAELGPPGARFLALRAQLT
EFSKALAQRCQRLADAERLFQLFREALTWAEEGQRVLAELEQERPGVVLQQLQLHWTRNP
DLPPAHFRKMWALATGLGSEAIRQECRWAWAWCQDTRLALDQKLEASLKLPLVGSTASLC
VSQVPAAPAHPPLRKAYSFDRNLGQSLSEPARHCHHAATIAACRRPEAGGGTLPQASPTV
PPPGISDPRSPNRLQLVLAEMVATEREYVRALEYTMENYFPELDRPDVPQGLRGQRAHLF
GNLEKLRDFHCHFFLRELEACTRHPPRVAYAFLRHRVQFGMYALYSKNKPRSDALMSSYG
HTFFKNKQQALGDHLDLASYLLKPIQRMGKYALLLQELARACGGPTQELSALQEAQSLVH
FQLRHGNDLLAMDAIQGCDVNLKEQGQLVRQDEFVVRTGRHKSVRRIFLFEELLLFSKPR
RGPTGVDTFAYKRSFKMADLGLTECCGDSNLRFEIWFRRRKARDTFVLQASSLAIKQAWT
ADISRLLWRQAIHNKEVRMAEMVSMGVGNKAFRDIAPSEEAINDRTVNYVLKCREVRSRA
SIAVAPFDHVSLYLGASNSLPGDPASCSVLGSLNLHLYRDPALLGLRCPLYPNFPEEAAL
EAEAELGSQPSLTAEDSEVSSQCPSASGSSGSDSSCVSGQALGRGLEDLPYV
Download sequence
Identical sequences G1QX96
XP_012360569.1.23891 XP_012360570.1.23891 XP_012360571.1.23891 ENSNLEP00000005567 ENSNLEP00000005567

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]