SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005832 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005832
Domain Number 1 Region: 829-1064
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.01e-56
Family DBL homology domain (DH-domain) 0.0000341
Further Details:      
 
Domain Number 2 Region: 1061-1190
Classification Level Classification E-value
Superfamily PH domain-like 5.63e-35
Family Pleckstrin-homology domain (PH domain) 0.0012
Further Details:      
 
Domain Number 3 Region: 645-700
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000628
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0088
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000005832
Domain Number - Region: 133-220
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00103
Family Ankyrin repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005832   Gene: ENSNLEG00000004756   Transcript: ENSNLET00000006140
Sequence length 1731
Comment pep:novel supercontig:Nleu1.0:GL397303.1:17255890:17585629:1 gene:ENSNLEG00000004756 transcript:ENSNLET00000006140 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELSCSEAPLYGQMTVYAKFDKNVYLPEDAEFYFTYDGSHQRHVMIAERIEDNVLQSSVP
GHGLQETVTVSVCLCSEGYSPVTMGSSSVTYVDNMACRLARLLVTQANRLTACSHQTLLT
PFALTAGALPALDEELVLALTHLELPLEWTVLGSSSLEVSSHRESLLHLAMRWGLAKLSQ
FFLCLPGGVQALALPNEEGATPLDLALRGGHSKLVEDVTNFQGRWSPSFSRVQLSEEASL
HYIHSSETLTLTLNHTAEHLLEADIKLFRKYFWDRAFLVKAFEQEARPEERTAMPSSGAE
TEEEIKNSVSSRSAAEKEDVKCVKSLVVQHNEHEDQHNLDLDRSFDVLKKSKPPSTLLAA
GRLSDMLNGGDEVYANCMVIDQVGDLDISYINIEGITATTSPESRGCTLGPQSSKHTVPT
ETSPSVYPLSENVKGTAHTEAQRSFMSPSSSCASNLNLSFGWHGFEKEQSHLKKRSSSLD
ALDADSEGEGHSEPSHICYTPGSQSSSRTGIPSGDELDSFETNTEPDFNISRAESLPLSS
NLQSKESLLSGVRSRSYSCSSPKISLGKTRLVRELTVCNSSEEQRAYSLPEPPREKRIQE
EEWDKYIIPAKSESEKYKVSRTFSFLMNRMTSPRNKSKTKSKDAKDKEKLNRHQFAPGTF
SGVLQCSVCDKTLLGKESLQCSNCNANVHKGCKDAAPACTKKFQEKYNKNKPQTILGSSS
FRDIPQPGLSLHPSSSMPVGLPTGRRETVGQVHPLSRSVPGTTLESFRRSATSLESESDS
NSCRSRSHSDELLQSMGSSPSTESFIMEDVVDSSLWSDLSSDAQEFEAESWSLVVDPSFC
NKQEKDVIKRQDVIFELMQTEMHHIQTLFIMSEIFRKGMKEELQLDHSTVDKIFPCLDEL
LEIHRHFFYSMKERRQESCAGSDRNFVIDQIGDILVQQFSEENASKMKKIYGEFCSHHKE
AVNLFKELQQNKKFQNFIKLRNSNLLARRRGIPECILLVTQRITKYPVLVERILQYTKER
TEEHKDLCKALCLIKDMIATVDLKVNEYEKNQKWLEILNKIENKTYTKLKNGHVFRKQAL
MSEERTLLYDGLVYWKTATGRFKDVLALLLTDVLLFLQEKDQKYIFAAVDQKPSVISLQK
LIAREVANEERGMFLISASSAGPEMYEIHTNSKEERNNWMRRIQQAVESCPEEKGGRTSE
SDEDKRKAEARVAKIQQCQEILTNQDQQICAYLEEKLHIYAELGELSGFEDVHLEPHLLI
KPDPGEPPQAASLLAAALKEAESLQVAVKASQMGAVSQSCEDSCGDSVLADTVSSHDVLG
SPTASLVTGGREGRGCSDVDPGIQGVVTDLAVSDAGEKVECRNFPGSSQSEIIQAIQNLT
RLLYSLQAALTIQDSHIEIHRLLLQQQEGLSFGHSVLRGGPLQDQKSRDADRKHEELANV
HELQHQLQQEQRRWFRRCDQQQRAQAARESWLQERERECQSQEELLLRSRGELDLQLQEY
QHSLERLREGQRLVEREQARMRAQQSLLGHWKHGRQRSLPAVLLPGGPEVMELNRSESLC
HENSFFINEALVQMSFNTFNKPNPSVIHQDATYPTTQSHSDLVRTSEHQVDLKMDPSQPS
NVSHKLWTAAGSGHQILPFHESSKDSCKNGSSMRKCSCTWTSPPGLWTGTTSTLKDLDTS
HTESPIPHDSNSHRPQLQAFITEAKLHLPTRTMTRQDGETGDGAKENIVYL
Download sequence
Identical sequences G1QY11
ENSNLEP00000005832 XP_003266110.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]