SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005898 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005898
Domain Number 1 Region: 284-344
Classification Level Classification E-value
Superfamily SH3-domain 5.38e-22
Family SH3-domain 0.00055
Further Details:      
 
Domain Number 2 Region: 106-159
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000000269
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000005898
Domain Number - Region: 346-400
Classification Level Classification E-value
Superfamily SH3-domain 0.0103
Family SH3-domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005898   Gene: ENSNLEG00000004845   Transcript: ENSNLET00000006207
Sequence length 402
Comment pep:novel supercontig:Nleu1.0:GL397269.1:24859251:25031660:1 gene:ENSNLEG00000004845 transcript:ENSNLET00000006207 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIPPSGPREDGVDGLPKEAVGAEQPPSPASTSSQESKLQKLKRSLSFKTKSLRSKSADNF
FQRTNSEDTKLQAHMVAEISPSSSPLPAPGSLTSTPARAGLHPGGKAHAFQEYIFKKPTF
CDVCNHMIVGTNAKHGLRCKACKMSIHHKCTDGLAPQRCMGKLPKGFRRYYSSPLLIHEQ
FGCIKEVMPIACGNKVDPVYETLRFGTSLAQRTKKGSSGSGSDSPHRTSTSDLVEVPEEA
NGPGGGYDLRKRSNSVFTYPENGTDDFRDPAKNINHQGSLSKDPLQMNTYVALYKFVPQE
NEDLEMRPGDIITVLEDSNEDWWKGKIQDRIGFFPANFVQRVQQNEKIFRCVRTFIGCKE
QGQITLKENQICVSSEGEQDGFIRVLSGKKKGLIPLDVLENI
Download sequence
Identical sequences G1QY77
ENSNLEP00000005898 XP_003256888.1.23891 ENSNLEP00000005898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]