SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005961 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005961
Domain Number 1 Region: 5-177
Classification Level Classification E-value
Superfamily Cyclophilin-like 3.51e-73
Family Cyclophilin (peptidylprolyl isomerase) 0.000000947
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005961   Gene: ENSNLEG00000004901   Transcript: ENSNLET00000006270
Sequence length 753
Comment pep:novel supercontig:Nleu1.0:GL397263.1:13191886:13249830:1 gene:ENSNLEG00000004901 transcript:ENSNLET00000006270 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGIKVQRPRCFFDIAINNQPAGRVVFELFSDVCPKTCENFRCLCTGEKGTGKSTQKPLHY
KSCLFHRVVKDFMVQGGDFSEGNGRGGESIYGGFFEDESFAVKHNKEFLLSMANRGKDTN
GSQFFITTKPTPHLDGHHVVFGQVISGQEVVREIENQKTDAASKPFAEVRILSCGELIPK
SKVKKEEKKRHKSSSSSSSSSSDSDSSSDSQSSSDSSDSESASEEKSKKRKKKHRKNSRK
HKKEKKKRKSKKSASSESEAENIEAQPQSTVRPEEIPPIPENRFLMRKSPPKADEKERKN
RERERERECNPPNSQPASYQRRLLVTRSGRKIKGRGPRRYRTPSRSRSRDRFRRSETPPH
WRQEMQRAQRMRVSSGERWIKGDKSELNEIKENQRSPVRVKERKITDHRNVSESPNRKND
KEKKVKDHKSNSKERDIRRNSEKDDKYKNKVKKRAKSKSRSKSKEKSKSKERDSKHNRHE
EKRMRSRSKGRDHENVKEKEKQSDSKGKDQERSRSKEKSKQLESKSNEHDHSKSKEKDRR
AQSRSRECDITKGKHSYNSRTRERSRSRDRSRRVRSRTRDRDRSRSKEYHRYREQEYRRR
GRSRSRERRTTPGRSRSKDRRRRRRDSRSSEREESQSRNKEKYRNQESKSSHRKENSESE
KRMYSKSRDHNSSNNSREKKADRDQSPFSKIKQSSQDNELKSSMLKNKEDEKIRSSVEKE
NQKSKGQENDHVHEKNKKFDHESSPGTDEDKSG
Download sequence
Identical sequences ENSNLEP00000005961 ENSNLEP00000005961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]