SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006072 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006072
Domain Number 1 Region: 64-152
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 3.7e-33
Family MHC antigen-recognition domain 0.0000109
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006072   Gene: ENSNLEG00000005019   Transcript: ENSNLET00000006385
Sequence length 171
Comment pep:novel supercontig:Nleu1.0:GL397342.1:7045278:7046114:-1 gene:ENSNLEG00000005019 transcript:ENSNLET00000006385 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GVVEPRILLLLLGALALTETWEGECGVGKETASAGRSERPARGAGPGEPRREEGRAGLSL
SPPGSHSLRYFSTTVSRPGRGEPRFIAVGYVDNTQFVRFDRDAASAMMEPRAQWVEQEGP
EYWDRETRSAKAHAETFPGNLRTLLRYYNESEATSSAGMSSMPKTTRITPP
Download sequence
Identical sequences ENSNLEP00000006072 ENSNLEP00000006072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]