SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006230 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006230
Domain Number 1 Region: 67-489
Classification Level Classification E-value
Superfamily RNI-like 8.89e-67
Family 28-residue LRR 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006230   Gene: ENSNLEG00000005128   Transcript: ENSNLET00000006546
Sequence length 552
Comment pep:novel supercontig:Nleu1.0:GL397268.1:23469791:23501493:-1 gene:ENSNLEG00000005128 transcript:ENSNLET00000006546 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQTRKKTSSEGETKPQTSIVNKFLRGSKAESRKQNNDLKTTDSQPSDWIQKTATSETAK
PLSSEMELRSSMEKNDQFLQKLGKKAVNRCLDLNNRGLTTADMKEMVALLPFLPDLEELD
ISWNDFVGGTLHSITQQMHLVSKLKILRLGSCRLTTDDVQALGEALEMIPELEELNLSWN
SKVGGNLPLILQKFQKGSKIQMIELVDCSLTSEDGTFLGQLLPMLQSLEVLDLSINRDIV
GSLNSIAQGLKSTSNLKVLKLHSCGLSQKSIKILDAAFRYLGELRKLDLSCNKDLSGGFE
DLPAQLVMLKHLQVLDLHQCSLTADDVMSLTQVIPLLSNLQELDLSANKKMGSSSENLLS
RLRFLPALKSLVINNCALERETFTALAEASVHLSALEVFNLSWNKCVGGNLKLLLETLKL
SMSLQVLRLSSCSLVTDDVALLASVIQMGHLAKLRKLDLSYNDSICDAGWTMFCQNVRLL
KELIELDISLRPSNFRDCGQWFRHLLYAVTKLPQITEIGMKRWILPASQEEELECFDQDK
KRSIHFDHGGFQ
Download sequence
Identical sequences G1QZ59
XP_003256480.1.23891 ENSNLEP00000006230 ENSNLEP00000006230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]