SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006277 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006277
Domain Number 1 Region: 889-1100
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.89e-40
Family DBL homology domain (DH-domain) 0.002
Further Details:      
 
Domain Number 2 Region: 1265-1460
Classification Level Classification E-value
Superfamily PH domain-like 4.2e-29
Family Pleckstrin-homology domain (PH domain) 0.0000886
Further Details:      
 
Domain Number 3 Region: 1090-1207
Classification Level Classification E-value
Superfamily PH domain-like 2.47e-23
Family Pleckstrin-homology domain (PH domain) 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006277   Gene: ENSNLEG00000005177   Transcript: ENSNLET00000006595
Sequence length 1462
Comment pep:novel supercontig:Nleu1.0:GL397298.1:22352567:22467140:1 gene:ENSNLEG00000005177 transcript:ENSNLET00000006595 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRGPKPPIAPKPRLTAPNEWRASVYLNDSLNKCSNGRLLCVDRGLDEGPRSIPKCSESE
TDEDYIVVPRAPLREDEPKDGDSVGNKALVSPEASGEEEEEHEEGGEACSLEGTGAGEDS
VAPTAPGAGVLSREGEEGTDLALEDEGEGCADEPGTQEQVSRSEEEEKLVQPHRECSLED
SGPWAGEGVFQSDLFLPHIHGEDHEPPDTPGEAEEEDEEGCASTDPVGADEGSGPDRPTE
DMGQDAEDASEEPPEKEEPAGVQEAEMAMDCPEVLEEGCEEATGVTGGEQVDLSEPPDHE
KKTNQEVAATTLEDRAQDEPAEESCQIVPFENDCTEDFVTSLTGSRYEFFPTESTSFCSE
SCSALSESAKDLESEQAPKLGLRAEENPLVGASYGQCGSLQGGAAEGPAAPDVVVVLEEE
AWDDALANPYVMGAGLLGQAAPGEGGQAASDALGGYGSKEEMNCEAEGGLVPADRKNTST
RVRPHSGKVAGYVPETVPEETGPEAGSSAPGIGSAAEEVGKTLLSLEGKALEASRALPAK
PRAFTLYPRSFSVEGREIPVSVYQEPEGSGLDDHRIKRKEDNLSLSCVIGSSGSFSQRNH
LPSSGTSTPSSMVDIPPPFDLACITKKPITKSSPSLLIESDSPDKYKKKKSSFKRFLALT
FKKKTENKLHVEVNVSSSRSSSESSYHGPSRILEVDRRSLSNSPQLKSRTGKLRASESPS
SLIFYRDGKRKGVPFSRTVSRVESFEDRSRPPFLPLPLTKPRSISFPSADTSDYENIPAM
NSDYENIQIPPRRPARAGAFTKLFEDQSRALSTANENDGYVDMSSFNAFESKQQSADQDT
ESAYTEPYKVCPISSAAPKEDLTSDEEQRSSEEEDSASRDPSLTHKLEGQSRALVIAQEL
LSSEKAYVEMLQHLNLDFHGAVMRALDDMDHEGRNTLAREELRQGLSELPAIHDLHQGIL
EELEERLSNWESQQKVADVFLAREQGFDHHATHILQFDRYLGLLSENCLHSPRLAAAVRE
FEQSVQGGSQTAKHRLLRVVQRLFQYQVLLTDYLNNLCPDSAEYDNTQGALSLISKVTDR
ANDSMEQGENLQKLVHIEHSVRGQGDLLQPGREFLKEGTLMKVTGKNRRPRHLFLMNDVL
LYTYPQKDGKYRLKNTLAVANMKVSRPVMEKVPYALKIETSESCLMLSASSCAERDEWYG
CLSRALPEDYKAQALAAFHHSVEVNGRVAPVSGALAPPTPLPCSHPSQGGGVQVSFARTE
RDENHLGLQIVCRNCSRNKYPLKYLKDRMAKVCDGCFGELKKRGRAVPGLMRERPVSMSF
PLSAPRFSGSAFSSVFQSINPSTFKKQKKVPSALTEVAASGEGSAISGYLSRCKRGKRHW
KKLWFVIKGKVLYTYMASEDKAAMESMPLLGFTIAPEKEEGSSEVGPIFHLYHKKTLFYS
FKAEDTNSAQRWIEAMEDASVL
Download sequence
Identical sequences ENSNLEP00000006277 ENSNLEP00000006277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]