SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006289 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006289
Domain Number 1 Region: 70-460
Classification Level Classification E-value
Superfamily Ras GEF 1.7e-94
Family Ras GEF 0.00042
Further Details:      
 
Domain Number 2 Region: 556-610
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000000139
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0017
Further Details:      
 
Domain Number 3 Region: 469-550
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000126
Family Polcalcin 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006289   Gene: ENSNLEG00000005105   Transcript: ENSNLET00000006610
Sequence length 670
Comment pep:novel supercontig:Nleu1.0:GL397360.1:3685869:3704133:-1 gene:ENSNLEG00000005105 transcript:ENSNLET00000006610 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GCQRLCGRGTQGWPGSSEQQVQEATSSAGLHSGVDELGVRSEPGGRLPERSLGPAHPAPA
AMAGTLDLDKGCTVEELLRGCIEAFDDSGKVRDPQLVRMFLMMHPWYIPSSQLAAKLLHI
YQQSRKDNSNSLQVKTCHLVRYWISAFPAEFDLNPELAEQIKELKALLDQEGNRRHSSLI
DIDSVPTYKWKRQVTQRNPVGQKKRKMSLLFDHLEPMELAEHLTYLEYRSFCKILFQDYH
SFVTHGCTVDNPVLERFISLFNSVSQWVQLMILSKPTAPQRALVITHFVHVAEKLLQLQN
FNTLMAVVGGLSHSSISRLKETHSHVSPETIKLWEGLTELVTATGNYGNYRRRLAACVGF
RFPILGVHLKDLVALQLALPDWLDPARTRLNGAKMKQLFSILEELAMVTSLRPPVQANPD
LLSLLTVSLDQYQMEDELYQLSLQREPRSKSSPTSPTSCTPPPRPPVLEEWTSAAKPKLD
QALVVEHIEKMVESVFRNFDVDGDGHISQEEFQIIRGNFPYLSAFGDLDQNQDGCISREE
MVSYFLRSSSVLGGRMGFVHNFQESNSLRPVACRHCKALILGIYKQGLKCRACGVNCHKQ
CKDRLSVECRRRAQSVSLEGSAPSPSPTHSHHHRAFSFSLPRPGRRGSRPPEIREEEVQT
VEDGVFDIHL
Download sequence
Identical sequences ENSNLEP00000006289

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]