SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006387 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006387
Domain Number 1 Region: 198-298
Classification Level Classification E-value
Superfamily SMAD/FHA domain 1.32e-28
Family Interferon regulatory factor 3 (IRF3), transactivation domain 0.00000187
Further Details:      
 
Domain Number 2 Region: 5-109
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.54e-27
Family Interferon regulatory factor 0.00000202
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006387   Gene: ENSNLEG00000005277   Transcript: ENSNLET00000006713
Sequence length 299
Comment pep:novel supercontig:Nleu1.0:GL397326.1:1602198:1607927:-1 gene:ENSNLEG00000005277 transcript:ENSNLET00000006713 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTAKPRILPWLVSQLDLGQLEGVAWVNKSRTEFHHWKHGRQDAQQEDFGIFCAWAEATG
AYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNSGVGDFSQQDT
SPDTNGGGSTSDTQEDILDELLGNLVLAPLPDPGPPSLAVAPEPCPQPLRSPSLDNPTPF
PNLGPSENPLKRLLVPGEDLITFTEGSGRSPRYALWFCVGESWPQDQPWTKRLVMVKRGV
PTCLRALVEIARVGGASSLENTVDLHISNSHPLSLTSDQYKAYLQDLVEGMDFQGPGEA
Download sequence
Identical sequences ENSNLEP00000006387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]