SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006641 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000006641
Domain Number - Region: 78-233
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.0205
Family DBL homology domain (DH-domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006641   Gene: ENSNLEG00000005491   Transcript: ENSNLET00000006974
Sequence length 693
Comment pep:novel supercontig:Nleu1.0:GL397360.1:4072909:4089800:1 gene:ENSNLEG00000005491 transcript:ENSNLET00000006974 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAAAGPSPGSGPGDSPEGPDGEAPERRRKAHGMLKLYYGLSEGEAAGRPAGPDPLDP
IDLNGAHFDPEVYLDKLRRECPLAQLMDSETDMVRQIRALDSDMQTLVYENYNKFISATD
TIRKMKNDFRKMEDEMDRLATNMAVITDFSARISATLQDRHERITKLAGVHALLRKLQFL
FELPSRLTKCVELGAYGQAVRYQGRAQAVLQQYQHLPSFRAIQDDCQVITARLAQQLRQR
FREGSSGAPEQAECVELLLALGEPAEELCEEFLAHARGRLEKELRSLEAELGPSPPAPDV
LEFTDHGGSGFVGGLCQVAAAYQELFAAQGPAAEKLAAFARELGSRYFALVERRLAQSGG
GDNSLLLLAIAPFHRQRVLGKLGKPGTLGVVSGSYARSGGWGRLGASAAGLRSRAWWGPQ
CWLSLPPLREAAPGYLECRMMLSLAEGLGHLEPQQRVINSPTWKRGPAVDLGTFSLQGEF
CSQGVREGLIVGFIRSMCQTAQSFCDSPGEKGGATPPALLLLLSRLCLDYETATISYILT
LTDEQFLVQDQFPVTPVSTLCAEARETARRLLTHYVKVQGLVISQMLRKSVETRDWLSTL
EPRNVRAVMKRVVEDTTAIDVQVGLLYEEGVRKAQSSDSSKRTFSVYSSSRQQGRYAPSY
TPSAPMDTNLLSNIQKLFSERIDVFSPVEFNKV
Download sequence
Identical sequences ENSNLEP00000006641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]