SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006649 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006649
Domain Number 1 Region: 1-94
Classification Level Classification E-value
Superfamily Pre-PUA domain 1.31e-41
Family Nip7p homolog, N-terminal domain 0.00000232
Further Details:      
 
Domain Number 2 Region: 95-170
Classification Level Classification E-value
Superfamily PUA domain-like 1.6e-26
Family PUA domain 0.0000147
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006649   Gene: ENSNLEG00000005492   Transcript: ENSNLET00000006982
Sequence length 180
Comment pep:novel supercontig:Nleu1.0:GL397289.1:22091037:22093647:1 gene:ENSNLEG00000005492 transcript:ENSNLET00000006982 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPLTEEETRVMFEKIAKYIGENIQAVVDRPDGTYSFRLHNDRVYYVSEKIMKLAANISG
DKLVSLGTCFGKFTKTHKFRLHVTALDYLAPYAKYKVWIKPGAEQSFLYGNHVLKSGLGR
ITESTSQYQGVVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETLT
Download sequence
Identical sequences G1R0C8
ENSNLEP00000006649 ENSNLEP00000006649 XP_012360285.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]