SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006685 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006685
Domain Number 1 Region: 172-314
Classification Level Classification E-value
Superfamily PH domain-like 2.31e-36
Family Third domain of FERM 0.0031
Further Details:      
 
Domain Number 2 Region: 69-174
Classification Level Classification E-value
Superfamily Second domain of FERM 4.19e-32
Family Second domain of FERM 0.0001
Further Details:      
 
Domain Number 3 Region: 2-67
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.3e-21
Family First domain of FERM 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006685   Gene: ENSNLEG00000005512   Transcript: ENSNLET00000007021
Sequence length 539
Comment pep:novel supercontig:Nleu1.0:GL397306.1:4776991:4831339:-1 gene:ENSNLEG00000005512 transcript:ENSNLET00000007021 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLQRDAKGQYLFDLLCHHLNLLEKDYFGIRFVDPDKQRHWLEFTKSVVKQLRSQPPFTMC
FRVKFYPADPAALKEEITRYLVFLQIKRDLYHGRLLCKTSDAALLAAYILQAEIGDYDSG
KHPEGYSSKFQFFPKHSEKLERKIAEIHKTELSGQTPATSELNFLRKAQTLETYGVDPHP
CKDVSGNAAFLAFTPFGFVVLQGNKRVHFIKWNEVTKLKFEGKTFYLYVSQKEEKKIILT
YFAPTPEACKHLWKCGIENQAFYKLEKSSQVRTVSSSNLFFKGSRFRYSGRVAKEVMESS
AKIKREPPEIHRAGMVPSRSCPSITHGPRLSSVPRTRRRAVHISIMEGLESLRDSAHSTP
VRSTSHGDTFLPHVRSSRTDSNERVAVIADEAYSPADSVLPTPVAEHSLELMLLSRQING
ATCSIEEEKESEASTPTATEVEALGEELRALCQGHSGPEEEQVNKFVLSVLRLLLVTMGL
LFVLLLLLIILTESDLDIAFFRDIRQTPEFEQFHYQYFCPLRRWFACKIRSVVSLLIDT
Download sequence
Identical sequences ENSNLEP00000006685 ENSNLEP00000006685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]